PDB entry 5iih

View 5iih on RCSB PDB site
Description: Crystal structure of Equine Serum Albumin in the presence of 2.5 mM zinc at pH 7.4
Class: transport protein
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, TRANSPORT PROTEIN
Deposited on 2016-03-01, released 2016-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35747 (Start-582)
      • see remark 999 (559)
    Domains in SCOPe 2.07: d5iiha1, d5iiha2, d5iiha3
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iihA (A:)
    dthkseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesae
    ncdkslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepd
    aqcaafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipk
    ldalkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkv
    hkecchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsd
    lpalaadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekcc
    aeadppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstp
    tlveigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdsl
    aerrpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatk
    eqlktvlgnfsafvakccgaedkeacfaeegpklvassqlala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iihA (A:)
    kseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaencd
    kslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaqc
    aafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipklda
    lkerillssakerlkcssfqnfgeravkawsvarlsqkfpkadfaevskivtdltkvhke
    cchgdllecaddradlakyicehqdsisgklkaccdkpllqkshciaevkeddlpsdlpa
    laadfaedkeickhykdakdvflgtflyeysrrhpdysvslllriaktyeatlekccaea
    dppacyrtvfdqftplveepkslvkkncdlfeevgeydfqnalivrytkkapqvstptlv
    eigrtlgkvgsrccklpeserlpcsenhlalalnrlcvlhektpvsekitkcctdslaer
    rpcfsaleldegyvpkefkaetftfhadictlpedekqikkqsalaelvkhkpkatkeql
    ktvlgnfsafvakccgaedkeacfaeegpklvassqlala