PDB entry 5iib

View 5iib on RCSB PDB site
Description: Crystal structure of red abalone egg VERL repeat 3 in complex with sperm lysin at 1.64 A resolution (crystal form II)
Class: cell adhesion
Keywords: cell adhesion, fertilization, egg-sperm interaction, gamete recognition, sperm receptor, egg coat, vitelline envelope, zp domain, zp-n domain, sperm acrosome, egg coat penetration
Deposited on 2016-03-01, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Egg-lysin
    Species: Haliotis rufescens [TaxId:6454]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iiba_
  • Chain 'B':
    Compound: Vitelline envelope sperm lysin receptor
    Species: Haliotis rufescens [TaxId:6454]
    Gene: VERL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WR62 (6-End)
      • expression tag (4-5)
  • Heterogens: EPE, SUC, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iibA (A:)
    rswhyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqt
    hwanymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymee
    inrmrpadvpvkymgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iibA (A:)
    flnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwanymlwi
    nkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmrpadv
    pvky
    

  • Chain 'B':
    No sequence available.