PDB entry 5iia

View 5iia on RCSB PDB site
Description: Crystal structure of red abalone egg VERL repeat 3 in complex with sperm lysin at 1.7 A resolution (crystal form I)
Class: cell adhesion
Keywords: cell adhesion, fertilization, egg-sperm interaction, gamete recognition, sperm receptor, egg coat, vitelline envelope, zp domain, zp-n domain, sperm acrosome, egg coat penetration
Deposited on 2016-03-01, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Egg-lysin
    Species: Haliotis rufescens [TaxId:6454]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iiaa_
  • Chain 'B':
    Compound: Vitelline envelope sperm lysin receptor
    Species: Haliotis rufescens [TaxId:6454]
    Gene: VERL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WR62 (7-End)
      • expression tag (5-6)
  • Chain 'C':
    Compound: Egg-lysin
    Species: Haliotis rufescens [TaxId:6454]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iiac_
  • Chain 'D':
    Compound: Vitelline envelope sperm lysin receptor
    Species: Haliotis rufescens [TaxId:6454]
    Gene: VERL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WR62 (7-End)
      • expression tag (4-6)
  • Chain 'E':
    Compound: Egg-lysin
    Species: Haliotis rufescens [TaxId:6454]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iiae_
  • Chain 'F':
    Compound: Vitelline envelope sperm lysin receptor
    Species: Haliotis rufescens [TaxId:6454]
    Gene: VERL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WR62 (7-End)
      • expression tag (6)
  • Chain 'G':
    Compound: Egg-lysin
    Species: Haliotis rufescens [TaxId:6454]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iiag_
  • Chain 'H':
    Compound: Vitelline envelope sperm lysin receptor
    Species: Haliotis rufescens [TaxId:6454]
    Gene: VERL
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iiaA (A:)
    rswhyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqt
    hwanymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymee
    inrmrpadvpvkymgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iiaA (A:)
    flnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwanymlwi
    nkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmrpadv
    pvkym
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5iiaC (C:)
    rswhyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqt
    hwanymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymee
    inrmrpadvpvkymgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iiaC (C:)
    flnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwanymlwi
    nkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmrpadv
    pvkym
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5iiaE (E:)
    rswhyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqt
    hwanymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymee
    inrmrpadvpvkymgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iiaE (E:)
    flnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwanymlwi
    nkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmrpadv
    pvkym
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5iiaG (G:)
    rswhyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqt
    hwanymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymee
    inrmrpadvpvkymgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iiaG (G:)
    kflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwanymlw
    inkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmrpad
    vpvkym
    

  • Chain 'H':
    No sequence available.