PDB entry 5ii2

View 5ii2 on RCSB PDB site
Description: Crystal Structure of the fifth bromodomain of human polybromo (PB1) in complex with 2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one
Class: transcription
Keywords: bromodomain, complex, small molecule, structural genomics consortium, SGC, transcription
Deposited on 2016-03-01, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein polybromo-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PBRM1, BAF180, PB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ii2a_
  • Chain 'B':
    Compound: Protein polybromo-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PBRM1, BAF180, PB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ii2b_
  • Heterogens: K, CIT, LU2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ii2A (A:)
    smsgispkkskymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikk
    pmdmekirshmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrd
    legd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ii2A (A:)
    skymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikkpmdmekirs
    hmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrdlegd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ii2B (B:)
    smsgispkkskymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikk
    pmdmekirshmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrd
    legd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ii2B (B:)
    skymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikkpmdmekirs
    hmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrdle