PDB entry 5ihy

View 5ihy on RCSB PDB site
Description: The crystal structure of Bacillus subtilis SeMet-YpgQ
Class: hydrolase
Keywords: HD domain, HYDROLASE
Deposited on 2016-03-01, released 2016-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BIS30_00575
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ihya_
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BIS30_00575
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ihyb_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ihyA (A:)
    gsakdpmtelkqadqirtwvqsvltgessghdwlhisrvadlavyigekenadlfiveta
    alvhdlidvklpdtirlsvsevynqlvtfgigkedadrvihiitkmsfrdreklegepls
    iegkvvqdadrldaigavgiarafmfagakghglygddqsayahffhkllrlidmmntdt
    arelaeerhefmlqyirqlekdipgidakts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ihyA (A:)
    mtelkqadqirtwvqsvltdwlhisrvadlavyigekenadlfivetaalvhdlidvklp
    dtirlsvsevynqlvtfgigkedadrvihiitkmsplsiegkvvqdadrldaigavgiar
    afmfagakghglygddqsayahffhkllrlidmmntdtarelaeerhefmlqyirqlekd
    ipgidakt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ihyB (B:)
    gsakdpmtelkqadqirtwvqsvltgessghdwlhisrvadlavyigekenadlfiveta
    alvhdlidvklpdtirlsvsevynqlvtfgigkedadrvihiitkmsfrdreklegepls
    iegkvvqdadrldaigavgiarafmfagakghglygddqsayahffhkllrlidmmntdt
    arelaeerhefmlqyirqlekdipgidakts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ihyB (B:)
    telkqadqirtwvqsvldwlhisrvadlavyigekenadlfivetaalvhdlidvklpdt
    irlsvsevynqlvtfgigkedadrvihiitkmsfrdreklegeplsiegkvvqdadrlda
    igavgiarafmfagakghglygddqsayahffhkllrlidmmntdtarelaeerhefmlq
    yirqlekdipgid