PDB entry 5ih9

View 5ih9 on RCSB PDB site
Description: MELK in complex with NVS-MELK8A
Class: transferase/transferase inhibitor
Keywords: kinase UBA domain inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-02-29, released 2016-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.7900000000000003 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maternal embryonic leucine zipper kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: MELK, KIAA0175
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14680 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5ih9a_
  • Heterogens: 6BF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ih9A (A:)
    mdydellkyyelhetigtggfakvklachiltgemvaikimdkntlgsdlprikteieal
    knlrhqhicqlyhvletankifmvleycpggelfdyiisqdrlseeetrvvfrqivsava
    yvhsqgyahrdlkpenllfdeyhklklidfglcakpkgnkdyhlqtccgslayaapeliq
    gksylgseadvwsmgillyvlmcgflpfdddnvmalykkimrgkydvpkwlspssilllq
    qmlqvdpkkrismknllnhpwimqdynypvewqsknpfihldddcvtelsvhhrnnrqtm
    edlislwqydhltatyllllakkargkpvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ih9A (A:)
    mdydellkyyelhetigtggfakvklachiltgemvaikimdkntlprikteiealknlr
    hqhicqlyhvletankifmvleycpggelfdyiisqdrlseeetrvvfrqivsavayvhs
    qgyahrdlkpenllfdeyhklklidfglcakslayaapeliqgksylgseadvwsmgill
    yvlmcgflpfdddnvmalykkimrgkydvpkwlspssilllqqmlqvdpkkrismknlln
    hpwimqdynypvewqsknpfihldddcvtelsvhhrnnrqtmedlislwqydhltatyll
    llakkarg