PDB entry 5igw

View 5igw on RCSB PDB site
Description: macrolide 2'-phosphotransferase type ii - complex with gdp and clarithromycin
Deposited on 2016-02-28, released 2017-04-26
The last revision was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrolide 2'-phosphotransferase II
    Species: Escherichia coli [TaxId:562]
    Gene: mphB, pO103_99
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GDP, MG, CTY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5igwA (A:)
    mskdikqvieiakkhnlflkeetiqfnesgldfqavfaqdnngidwvlrlprredvmprt
    kvekqaldlvnkyaisfqapnwiiyteeliaykkldgvpagtidhnignyiweidinnvp
    elfhkslgrvlaelhsipsnkaaaldlvvhtpeearmsmkqrmdavrakfgvgenlwnrw
    qawlndddmwpkktglihgdvhaghtmidkdanvtglidwteakvtdvshdfifnyrafg
    eeglealilaykeiggyywpkmkehiielnaaypvsiaefalvsgieeyeqmakealevq
    gs
    

    Sequence, based on observed residues (ATOM records):
    >5igwA (A:)
    skdikqvieiakkhnlflkeetiqfnesgldfqavfaqdnngidwvlrlprredvmprtk
    vekqaldlvnkyaisfqapnwiiyteeliaykkldgvpagtidhgnyiweidinnvpelf
    hkslgrvlaelhsipsnkaaaldlvvhtpeearmsmkqrmdavrakfgvgenlwnrwqaw
    lndddmwpkktglihgdvhaghtmidkdanvtglidwteakvtdvshdfifnyrafgeeg
    lealilaykeiggyywpkmkehiielnaaypvsiaefalvsgieeyeqmakealev