PDB entry 5igs

View 5igs on RCSB PDB site
Description: macrolide 2'-phosphotransferase type i - complex with guanosine and oleandomycin
Deposited on 2016-02-28, released 2017-04-26
The last revision was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrolide 2'-phosphotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: mphA, mph(A), mph2, AL500_00070, AL500_01375, AL500_26825, AL500_27285, AM267_25240, AM268_24740, AN205_25580, AN669_16770, APT94_14590, APU01_18860, APU07_01730, APU10_01345, APU12_00980, APZ14_31330, ASU34_20250, AUO99_00035, AZ95_0038, BN3204_920003, ECONIH1_26770, ERS085366_04054, ERS085367_04848, ERS139269_04809, ERS150873_04753, ETN48_p0083, FH07_00510, orf00017, pCTXM123_C0996_11, pKC394-009, SK74_04859, SK86_03516, UN86_19875
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IPA, ZIO, GMP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5igsA (A:)
    mtvvttadtsqlyalaarhglklhgpltvnelgldyriviatvddgrrwvlriprraevs
    akvepearvlamlknrlpfavpdwrvanaelvaypmledstamviqpgsstpdwvvpqds
    evfaesfatalaalhavpisaavdagmlirtptqarqkvaddvdrvrrefvvndkrlhrw
    qrwldddsswpdfsvvvhgdlyvghvlidntervsgmidwsearvddpaidmaahlmvfg
    eeglakllltyeaaggrvwprlahhiaerlafgavtyalfaldsgneeylaaakaqlaaa
    e
    

    Sequence, based on observed residues (ATOM records):
    >5igsA (A:)
    tvvttadtsqlyalaarhglklhgpltvnelgldyriviatvddgrrwvlriprraevsa
    kvepearvlamlknrlpfavpdwrvanaelvaypmledstamviqpgsstpdwvvpqdse
    vfaesfatalaalhavpisaavdagmlirtptqarqkvaddvdrvrrefvvndkrlhrwq
    rwldddsswpdfsvvvhgdlyvghvlidntervsgmidwsearvddpaidmaahlmvfge
    eglakllltyeaaggrvwprlahhiaerlafgavtyalfaldsgneeylaaakaqlaaae