PDB entry 5igq

View 5igq on RCSB PDB site
Description: wd40 domain of human e3 ubiquitin ligase cop1 (rfwd2) bound to peptide from trib1
Deposited on 2016-02-28, released 2016-04-20
The last revision was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 3.9 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase RFWD2
    Species: Homo sapiens [TaxId:9606]
    Gene: RFWD2, COP1, RNF200
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase RFWD2
    Species: Homo sapiens [TaxId:9606]
    Gene: RFWD2, COP1, RNF200
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase RFWD2
    Species: Homo sapiens [TaxId:9606]
    Gene: RFWD2, COP1, RNF200
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase RFWD2
    Species: Homo sapiens [TaxId:9606]
    Gene: RFWD2, COP1, RNF200
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: E3 ubiquitin-protein ligase RFWD2
    Species: Homo sapiens [TaxId:9606]
    Gene: RFWD2, COP1, RNF200
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: E3 ubiquitin-protein ligase RFWD2
    Species: Homo sapiens [TaxId:9606]
    Gene: RFWD2, COP1, RNF200
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Tribbles homolog 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Tribbles homolog 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Tribbles homolog 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Tribbles homolog 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Tribbles homolog 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Tribbles homolog 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5igqA (A:)
    mhhhhhhasqldefqeclskftrynsvrplatlsyasdlyngssivssiefdrdcdyfai
    agvtkkikvyeydtviqdavdihypenemtcnskisciswssyhknllassdyegtvilw
    dgftgqrskvyqehekrcwsvdfnlmdpkllasgsddakvklwstnldnsvasieakanv
    ccvkfspssryhlafgcadhcvhyydlrntkqpimvfkghrkavsyakfvsgeeivsast
    dsqlklwnvgkpyclrsfkghineknfvglasngdyiacgsennslylyykglsktlltf
    kfdtvksvldkdrkeddtnefvsavcwralpdgesnvliaansqgtikvlelv
    

    Sequence, based on observed residues (ATOM records):
    >5igqA (A:)
    efqeclskftrynsvrplatlsyalyngssivssiefdrdcdyfaiagvtkkikvyeydt
    viqdaihypenemtcnskisciswssyhknllassdyegtvilwdgftgqrskvyqehek
    rcwsvdfnlmdpkllasgsddakvklwstnldnsvasieakanvccvkfspssryhlafg
    cadhcvhyydlrntkqpimvfkghrkavsyakfvsgeeivsastdsqlklwnvgkpyclr
    sfkghineknfvglasngdyiacgsennslylyykglsktlltfkfdtvnefvsavcwra
    lpdgesnvliaansqgtikvlelv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5igqB (B:)
    mhhhhhhasqldefqeclskftrynsvrplatlsyasdlyngssivssiefdrdcdyfai
    agvtkkikvyeydtviqdavdihypenemtcnskisciswssyhknllassdyegtvilw
    dgftgqrskvyqehekrcwsvdfnlmdpkllasgsddakvklwstnldnsvasieakanv
    ccvkfspssryhlafgcadhcvhyydlrntkqpimvfkghrkavsyakfvsgeeivsast
    dsqlklwnvgkpyclrsfkghineknfvglasngdyiacgsennslylyykglsktlltf
    kfdtvksvldkdrkeddtnefvsavcwralpdgesnvliaansqgtikvlelv
    

    Sequence, based on observed residues (ATOM records):
    >5igqB (B:)
    efqeclskftrynsvrplatlsyalyngssivssiefdrdcdyfaiagvtkkikvyeydt
    viqdaihypenemtcnskisciswssyhknllassdyegtvilwdgftgqrskvyqehek
    rcwsvdfnlmdpkllasgsddakvklwstnldnsvasieakanvccvkfspssryhlafg
    cadhcvhyydlrntkqpimvfkghrkavsyakfvsgeeivsastdsqlklwnvgkpyclr
    sfkghineknfvglasngdyiacgsennslylyykglsktlltfkfdtvnefvsavcwra
    lpdgesnvliaansqgtikvlelv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5igqC (C:)
    mhhhhhhasqldefqeclskftrynsvrplatlsyasdlyngssivssiefdrdcdyfai
    agvtkkikvyeydtviqdavdihypenemtcnskisciswssyhknllassdyegtvilw
    dgftgqrskvyqehekrcwsvdfnlmdpkllasgsddakvklwstnldnsvasieakanv
    ccvkfspssryhlafgcadhcvhyydlrntkqpimvfkghrkavsyakfvsgeeivsast
    dsqlklwnvgkpyclrsfkghineknfvglasngdyiacgsennslylyykglsktlltf
    kfdtvksvldkdrkeddtnefvsavcwralpdgesnvliaansqgtikvlelv
    

    Sequence, based on observed residues (ATOM records):
    >5igqC (C:)
    efqeclskftrynsvrplatlsyalyngssivssiefdrdcdyfaiagvtkkikvyeydt
    viqdaihypenemtcnskisciswssyhknllassdyegtvilwdgftgqrskvyqehek
    rcwsvdfnlmdpkllasgsddakvklwstnldnsvasieakanvccvkfspssryhlafg
    cadhcvhyydlrntkqpimvfkghrkavsyakfvsgeeivsastdsqlklwnvgkpyclr
    sfkghineknfvglasngdyiacgsennslylyykglsktlltfkfdtvnefvsavcwra
    lpdgesnvliaansqgtikvlelv
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5igqD (D:)
    mhhhhhhasqldefqeclskftrynsvrplatlsyasdlyngssivssiefdrdcdyfai
    agvtkkikvyeydtviqdavdihypenemtcnskisciswssyhknllassdyegtvilw
    dgftgqrskvyqehekrcwsvdfnlmdpkllasgsddakvklwstnldnsvasieakanv
    ccvkfspssryhlafgcadhcvhyydlrntkqpimvfkghrkavsyakfvsgeeivsast
    dsqlklwnvgkpyclrsfkghineknfvglasngdyiacgsennslylyykglsktlltf
    kfdtvksvldkdrkeddtnefvsavcwralpdgesnvliaansqgtikvlelv
    

    Sequence, based on observed residues (ATOM records):
    >5igqD (D:)
    efqeclskftrynsvrplatlsyalyngssivssiefdrdcdyfaiagvtkkikvyeydt
    viqdaihypenemtcnskisciswssyhknllassdyegtvilwdgftgqrskvyqehek
    rcwsvdfnlmdpkllasgsddakvklwstnldnsvasieakanvccvkfspssryhlafg
    cadhcvhyydlrntkqpimvfkghrkavsyakfvsgeeivsastdsqlklwnvgkpyclr
    sfkghineknfvglasngdyiacgsennslylyykglsktlltfkfdtvnefvsavcwra
    lpdgesnvliaansqgtikvlelv
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5igqE (E:)
    mhhhhhhasqldefqeclskftrynsvrplatlsyasdlyngssivssiefdrdcdyfai
    agvtkkikvyeydtviqdavdihypenemtcnskisciswssyhknllassdyegtvilw
    dgftgqrskvyqehekrcwsvdfnlmdpkllasgsddakvklwstnldnsvasieakanv
    ccvkfspssryhlafgcadhcvhyydlrntkqpimvfkghrkavsyakfvsgeeivsast
    dsqlklwnvgkpyclrsfkghineknfvglasngdyiacgsennslylyykglsktlltf
    kfdtvksvldkdrkeddtnefvsavcwralpdgesnvliaansqgtikvlelv
    

    Sequence, based on observed residues (ATOM records):
    >5igqE (E:)
    efqeclskftrynsvrplatlsyalyngssivssiefdrdcdyfaiagvtkkikvyeydt
    viqdaihypenemtcnskisciswssyhknllassdyegtvilwdgftgqrskvyqehek
    rcwsvdfnlmdpkllasgsddakvklwstnldnsvasieakanvccvkfspssryhlafg
    cadhcvhyydlrntkqpimvfkghrkavsyakfvsgeeivsastdsqlklwnvgkpyclr
    sfkghineknfvglasngdyiacgsennslylyykglsktlltfkfdtvnefvsavcwra
    lpdgesnvliaansqgtikvlelv
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5igqF (F:)
    mhhhhhhasqldefqeclskftrynsvrplatlsyasdlyngssivssiefdrdcdyfai
    agvtkkikvyeydtviqdavdihypenemtcnskisciswssyhknllassdyegtvilw
    dgftgqrskvyqehekrcwsvdfnlmdpkllasgsddakvklwstnldnsvasieakanv
    ccvkfspssryhlafgcadhcvhyydlrntkqpimvfkghrkavsyakfvsgeeivsast
    dsqlklwnvgkpyclrsfkghineknfvglasngdyiacgsennslylyykglsktlltf
    kfdtvksvldkdrkeddtnefvsavcwralpdgesnvliaansqgtikvlelv
    

    Sequence, based on observed residues (ATOM records):
    >5igqF (F:)
    efqeclskftrynsvrplatlsyalyngssivssiefdrdcdyfaiagvtkkikvyeydt
    viqdaihypenemtcnskisciswssyhknllassdyegtvilwdgftgqrskvyqehek
    rcwsvdfnlmdpkllasgsddakvklwstnldnsvasieakanvccvkfspssryhlafg
    cadhcvhyydlrntkqpimvfkghrkavsyakfvsgeeivsastdsqlklwnvgkpyclr
    sfkghineknfvglasngdyiacgsennslylyykglsktlltfkfdtvnefvsavcwra
    lpdgesnvliaansqgtikvlelv
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records:
    >5igqU (U:)
    sdqivpeyqed
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records:
    >5igqV (V:)
    sdqivpey
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records:
    >5igqW (W:)
    sdqivpey
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >5igqX (X:)
    sdqivpey
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records:
    >5igqY (Y:)
    sdqivpey
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records:
    >5igqZ (Z:)
    sdqivpey