PDB entry 5igo

View 5igo on RCSB PDB site
Description: wd40 domain of arabidopsis thaliana e3 ubiquitin ligase cop1 in complex with peptide from trib1
Deposited on 2016-02-28, released 2016-04-20
The last revision was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase COP1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: COP1, At2g32950, T21L14.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase COP1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: COP1, At2g32950, T21L14.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase COP1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: COP1, At2g32950, T21L14.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase COP1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: COP1, At2g32950, T21L14.11
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Tribbles homolog 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: Tribbles homolog 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: Tribbles homolog 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Tribbles homolog 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5igoA (A:)
    mhhhhhhhhtftrysrlrviaeirhgdifhsanivssiefdrddelfatagvsrcikvfd
    fssvvnepadmqcpivemstrsklsclswnkheknhiassdyegivtvwdvttrqslmey
    eehekrawsvdfsrtepsmlvsgsddckvkvwctrqeasvinidmkaniccvkynpgssn
    yiavgsadhhihyydlrnisqplhvfsghkkavsyvkflsnnelasastdstlrlwdvkd
    nlpvrtfrghtneknfvgltvnseylacgsetnevyvyhkeitrpvtshrfgspdmddae
    eeagsyfisavcwksdsptmltansqgtikvlvlaa
    

    Sequence, based on observed residues (ATOM records):
    >5igoA (A:)
    srlrviaeirhgdifhsanivssiefdrddelfatagvsrcikvfdfssvvnepadmqcp
    ivemstrsklsclswnkheknhiassdyegivtvwdvttrqslmeyeehekrawsvdfsr
    tepsmlvsgsddckvkvwctrqeasvinidmkaniccvkynpgssnyiavgsadhhihyy
    dlrnisqplhvfsghkkavsyvkflsnnelasastdstlrlwdvkdnlpvrtfrghtnek
    nfvgltvnseylacgsetnevyvyhkeitrpvtshrfgspdmddaeeeagsyfisavcwk
    sdsptmltansqgtikvlvla
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5igoB (B:)
    mhhhhhhhhtftrysrlrviaeirhgdifhsanivssiefdrddelfatagvsrcikvfd
    fssvvnepadmqcpivemstrsklsclswnkheknhiassdyegivtvwdvttrqslmey
    eehekrawsvdfsrtepsmlvsgsddckvkvwctrqeasvinidmkaniccvkynpgssn
    yiavgsadhhihyydlrnisqplhvfsghkkavsyvkflsnnelasastdstlrlwdvkd
    nlpvrtfrghtneknfvgltvnseylacgsetnevyvyhkeitrpvtshrfgspdmddae
    eeagsyfisavcwksdsptmltansqgtikvlvlaa
    

    Sequence, based on observed residues (ATOM records):
    >5igoB (B:)
    srlrviaeirhgdifhsanivssiefdrddelfatagvsrcikvfdfssvvnepadmqcp
    ivemstrsklsclswnkheknhiassdyegivtvwdvttrqslmeyeehekrawsvdfsr
    tepsmlvsgsddckvkvwctrqeasvinidmkaniccvkynpgssnyiavgsadhhihyy
    dlrnisqplhvfsghkkavsyvkflsnnelasastdstlrlwdvkdnlpvrtfrghtnek
    nfvgltvnseylacgsetnevyvyhkeitrpvtshrfgspdmddaeeagsyfisavcwks
    dsptmltansqgtikvlvlaa
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5igoC (C:)
    mhhhhhhhhtftrysrlrviaeirhgdifhsanivssiefdrddelfatagvsrcikvfd
    fssvvnepadmqcpivemstrsklsclswnkheknhiassdyegivtvwdvttrqslmey
    eehekrawsvdfsrtepsmlvsgsddckvkvwctrqeasvinidmkaniccvkynpgssn
    yiavgsadhhihyydlrnisqplhvfsghkkavsyvkflsnnelasastdstlrlwdvkd
    nlpvrtfrghtneknfvgltvnseylacgsetnevyvyhkeitrpvtshrfgspdmddae
    eeagsyfisavcwksdsptmltansqgtikvlvlaa
    

    Sequence, based on observed residues (ATOM records):
    >5igoC (C:)
    rysrlrviaeirhgdifhsanivssiefdrddelfatagvsrcikvfdfssvvnepdmqc
    pivemstrsklsclswnkheknhiassdyegivtvwdvttrqslmeyeehekrawsvdfs
    rtepsmlvsgsddckvkvwctrqeasvinidmkaniccvkynpgssnyiavgsadhhihy
    ydlrnisqplhvfsghkkavsyvkflsnnelasastdstlrlwdvkdnlpvrtfrghtne
    knfvgltvnseylacgsetnevyvyhkeitrpvtshrfgspdmddaeeeagsyfisavcw
    ksdsptmltansqgtikvlvlaa
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5igoD (D:)
    mhhhhhhhhtftrysrlrviaeirhgdifhsanivssiefdrddelfatagvsrcikvfd
    fssvvnepadmqcpivemstrsklsclswnkheknhiassdyegivtvwdvttrqslmey
    eehekrawsvdfsrtepsmlvsgsddckvkvwctrqeasvinidmkaniccvkynpgssn
    yiavgsadhhihyydlrnisqplhvfsghkkavsyvkflsnnelasastdstlrlwdvkd
    nlpvrtfrghtneknfvgltvnseylacgsetnevyvyhkeitrpvtshrfgspdmddae
    eeagsyfisavcwksdsptmltansqgtikvlvlaa
    

    Sequence, based on observed residues (ATOM records):
    >5igoD (D:)
    rysrlrviaeirhgdifhsanivssiefdrddelfatagvsrcikvfdfssvvnepmqcp
    ivemstrsklsclswnkheknhiassdyegivtvwdvttrqslmeyeehekrawsvdfsr
    tepsmlvsgsddckvkvwctrqeasvinidmkaniccvkynpgssnyiavgsadhhihyy
    dlrnisqplhvfsghkkavsyvkflsnnelasastdstlrlwdvkdnlpvrtfrghtnek
    nfvgltvnseylacgsetnevyvyhkeitrpvtshrfgspdmddaeeeagsyfisavcwk
    sdsptmltansqgtikvlvlaa
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records:
    >5igoU (U:)
    sdqivpey
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records:
    >5igoV (V:)
    sdqivpey
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records:
    >5igoW (W:)
    sdqivpey
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records:
    >5igoX (X:)
    sdqivpey