PDB entry 5igl

View 5igl on RCSB PDB site
Description: Crystal structure of the second bromodomain of human TAF1L in complex with bromosporine (BSP)
Class: transcription
Keywords: Transcription, TAF1/TAFII250, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2016-02-28, released 2016-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID subunit 1-like
    Species: Homo sapiens [TaxId:9606]
    Gene: TAF1L
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IZX4 (23-End)
      • expression tag (12-22)
    Domains in SCOPe 2.08: d5igla1, d5igla2
  • Heterogens: BMF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iglA (A:)
    mhhhhhhssgvdlgtenlyfqsmqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdy
    ykmivnpvdletirkniskhkyqsresflddvnlilansvkyngpesqytktaqeivnic
    yqtiteydehltqlekdictakeaaleeaelesld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iglA (A:)
    lgtenlyfqsmqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykmivnpvdlet
    irkniskhkyqsresflddvnlilansvkyngpesqytktaqeivnicyqtiteydehlt
    qlekdictakeaaleeael