PDB entry 5iga

View 5iga on RCSB PDB site
Description: Crystal structure of a marine metagenome TRAP solute binding protein specific for aromatic acid ligands (Sorcerer II Global Ocean Sampling Expedition, unidentified microbe, locus tag GOS_1523157, Triple Surface Mutant K158A_K223A_K313A) in complex with co-purified parahydroxybenzoate
Class: transport protein
Keywords: transport protein
Deposited on 2016-02-27, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trap transporter solute binding protein
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IGA (Start-340)
    Domains in SCOPe 2.07: d5igaa1, d5igaa2
  • Heterogens: PEG, TRS, PHB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5igaA (A:)
    mhhhhhhssgvdlgtenlyfqsmevvlkfhsfppmpansnakfvkpwsekvlaesngeik
    veiypamqlggkppqlvdqvrdgvvdivwtvagytpgrfphleafelpfmpasaeatsqa
    lqeyvdtvaasdlkdykvlavfchapgkihtkekviasaadlngmkmrgptrvitkmleg
    lgatpvgmpvpavagalskgvidgmvvpweimpsfklheltaahttvsgsrglyttpflf
    lmnkakyeslsdehkkvidnnaglalaklagqlwdgfevparklaldaggtihslsggpl
    aemkaagegleadwiksandrgldgamlvktakdliskydk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5igaA (A:)
    smevvlkfhsfppmpansnakfvkpwsekvlaesngeikveiypamqlggkppqlvdqvr
    dgvvdivwtvagytpgrfphleafelpfmpasaeatsqalqeyvdtvaasdlkdykvlav
    fchapgkihtkekviasaadlngmkmrgptrvitkmleglgatpvgmpvpavagalskgv
    idgmvvpweimpsfklheltaahttvsgsrglyttpflflmnkakyeslsdehkkvidnn
    aglalaklagqlwdgfevparklaldaggtihslsggplaemkaagegleadwiksandr
    gldgamlvktakdliskydk