PDB entry 5ifw

View 5ifw on RCSB PDB site
Description: quantitative interaction mapping reveals an extended ubiquitin regulatory domain in aspl that disrupts functional p97 hexamers and induces cell death
Deposited on 2016-02-26, released 2016-10-26
The last revision was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tether containing UBX domain for GLUT4
    Species: Homo sapiens [TaxId:9606]
    Gene: ASPSCR1, ASPL, RCC17, TUG, UBXD9, UBXN9
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Gene: VCP
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ifwA (A:)
    pvdrepvvchpdleerlqawpaelpdeffeltvddvrrrlaqlkserkrleeaplvtkaf
    reaqikeklerypkvalrvlfpdryvlqgffrpsetvgdlrdfvrshlgnpelsfylfit
    ppktvlddhtqtlfqanlfpaalvhlgaeepagvylepgllehaispsaadvlvarymsr
    aagspspl
    

    Sequence, based on observed residues (ATOM records):
    >5ifwA (A:)
    pvdrepvvchpdleerlqawpaelpdeffeltvddvrrrlaqlkserkrleeaplvtkaf
    reaqikeklerypkvalrvlfpdryvlqgffrpsetvgdlrdfvrshlgnpelsfylfit
    ppktvlddhtqtlfqanlfpaalvhlgaeepagvylepgllehaispsaadvlvarymsr
    aag
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ifwB (B:)
    gsasgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvll
    kgkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpi
    ddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapd
    tvihcegepikredeeeslnevgyddiggcrkqlaqikemvelplrhpalfkaigvkppr
    gillygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapa
    iifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrr
    fgrfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaa
    lqairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedi
    ggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanf
    isikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadr
    vinqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailka
    nlrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsa
    meveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqg
    gagpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records):
    >5ifwB (B:)
    stailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivl
    sddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfe
    vylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikre
    deeeslnevgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgkt
    liaravanetgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapg
    everrivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrl
    eilqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkdetidaevmnsl
    avtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqkgvlfygppgc
    gktllakaianecqanfisikgpelltmwfgeseanvreifdkarqaapcvlffdeldsi
    akdrvinqiltemdgmsnvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailk
    anlrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnps
    ameveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaq