PDB entry 5ifu

View 5ifu on RCSB PDB site
Description: crystal structure of prolyl-trna synthetase (prors, proline--trna ligase) from plasmodium falciparum in complex with glyburide
Deposited on 2016-02-26, released 2016-11-16
The last revision was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.4499999999999997 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proline--tRNA ligase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: proRS, PFL0670c
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Proline--tRNA ligase
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: proRS, PFL0670c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8I5R7 (8-505)
      • expression tag (4-7)
  • Heterogens: GBM, CL, FMT, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ifuA (A:)
    mahhhhhhsnilgitskkienfsdwytqvivkselieyydisgcyilrpaayyiwecvqa
    ffnkeikklnvensyfplfvtknklekeknhiegfspevawvtkygdsnlpeeiairpts
    etimysvfpkwirsyrdlplklnqwntvvrwefkqptpfirtreflwqeghtahkneeea
    vklvfdildlyrrwyeeylavpiikgiksegekfgganftstaeafisengraiqaatsh
    ylgtnfakmfkiefedenevkqyvhqtswgcttrsigimimthgddkglvlppnvskykv
    vivpifykttdenaihsyckdiekilknaqincvyddrasyspgykfnhwelrgipirie
    vgpkdlqnnscvivrrdnnekcnvkkesvlletqqmlvdihknlflkakkklddsivqvt
    sfsevmnalnkkkmvlapwcediateeeikketqrlslnqtnsettlsgamkplcipldq
    ppmppnmkcfwsgkpakrwclfgrsy
    

    Sequence, based on observed residues (ATOM records):
    >5ifuA (A:)
    ilgitskkienfsdwytqvivkselieyydisgcyilrpaayyiwecvqaffnkeikkln
    vensyfplfvtsetimysvfpkwirsyrdlplklnqwntvtreflwqeghtahkneeeav
    klvfdildlyrrwyeeylavpiikgiksegekfgganftstaeafisengraiqaatshy
    lgtnfakmfkiefedenevkqyvhqtswgcttrsigimimthgddkglvlppnvskykvv
    ivpifykttdenaihsyckdiekilknaqincvyddrasyspgykfnhwelrgipiriev
    gpkdlqnnscvivrrdnnekcnvkkesvlletqqmlvdihknlflkakkklddsivqvts
    fsevmnalnkkkmvlapwcediateeeikketqrlslnlsgamkplcipldqppmppnmk
    cfwsgkpakrwclfgrsy
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ifuB (B:)
    mahhhhhhsnilgitskkienfsdwytqvivkselieyydisgcyilrpaayyiwecvqa
    ffnkeikklnvensyfplfvtknklekeknhiegfspevawvtkygdsnlpeeiairpts
    etimysvfpkwirsyrdlplklnqwntvvrwefkqptpfirtreflwqeghtahkneeea
    vklvfdildlyrrwyeeylavpiikgiksegekfgganftstaeafisengraiqaatsh
    ylgtnfakmfkiefedenevkqyvhqtswgcttrsigimimthgddkglvlppnvskykv
    vivpifykttdenaihsyckdiekilknaqincvyddrasyspgykfnhwelrgipirie
    vgpkdlqnnscvivrrdnnekcnvkkesvlletqqmlvdihknlflkakkklddsivqvt
    sfsevmnalnkkkmvlapwcediateeeikketqrlslnqtnsettlsgamkplcipldq
    ppmppnmkcfwsgkpakrwclfgrsy
    

    Sequence, based on observed residues (ATOM records):
    >5ifuB (B:)
    hhhhsnilgitskkienfsdwytqvivkselieyydisgcyilrpaayyiwecvqaffnk
    eikklnvensyfplfvsetimysvfpkwirsyrdlplklnqwntvvrwefkqpttreflw
    qeghtahkneeeavklvfdildlyrrwyeeylavpiikgiksegekfgganftstaeafi
    sengraiqaatshylgtnfakmfkiefedenevkqyvhqtswgcttrsigimimthgddk
    glvlppnvskykvvivpifyenaihsyckdiekilknaqincvyddrasyspgykfnhwe
    lrgipirievgpkdlqnnscvivrrdnnekcnvkkesvlletqqmlvdihknlflkakkk
    lddsivqvtsfsevmnalnkkkmvlapwcediateeeikketqrlssgamkplcipldqp
    pmppnmkcfwsgkpakrwclfgrsy