PDB entry 5ifn

View 5ifn on RCSB PDB site
Description: human pspc1 homodimer
Deposited on 2016-02-26, released 2017-08-09
The last revision was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 3.17 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Paraspeckle component 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PSPC1, PSP1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Paraspeckle component 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PSPC1, PSP1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ifnA (A:)
    mgftidiksflkpgektytqrcrlfvgnlptditeedfkrlferygepsevfinrdrgfg
    firlesrtlaeiakaeldgtilksrplrirfathgaaltvknlspvvsnelleqafsqfg
    pvekavvvvddrgratgkgfvefaakpparkalercgdgaflltttprpvivepmeqfdd
    edglpeklmqktqqyhkereqpprfaqpgtfefeyasrwkaldemekqqreqvdrnirea
    kekleaemeaarhehqlmlm
    

    Sequence, based on observed residues (ATOM records):
    >5ifnA (A:)
    tidiksflkpgektytqrcrlfvgnlptditeedfkrlferygepsevfinrdrgfgfir
    lesrtlaeiakaeldgtilksrplrirfathgaaltvknlspvvsnelleqafsqfgpve
    kavvvvddrgratgkgfvefaakpparkalercgdgaflltttprpvivepmeqfddedg
    lpeklmqktqqyhkereqpprfaqpgtfefeyasrwkaldemekqqreqvdrnireakek
    leaemeaarhehqlmlm
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ifnB (B:)
    mgftidiksflkpgektytqrcrlfvgnlptditeedfkrlferygepsevfinrdrgfg
    firlesrtlaeiakaeldgtilksrplrirfathgaaltvknlspvvsnelleqafsqfg
    pvekavvvvddrgratgkgfvefaakpparkalercgdgaflltttprpvivepmeqfdd
    edglpeklmqktqqyhkereqpprfaqpgtfefeyasrwkaldemekqqreqvdrnirea
    kekleaemeaarhehqlmlm
    

    Sequence, based on observed residues (ATOM records):
    >5ifnB (B:)
    tidiksflkpgektytqrcrlfvgnlptditeedfkrlferygepsevfinrdrgfgfir
    lesrtlaeiakaeldgtilksrplrirfathgaaltvknlspvvsnelleqafsqfgpve
    kavvvvddrgratgkgfvefaakpparkalercgdgaflltttprpvivepmeqfddedg
    lpeklmqktqqyhkereqpprfaqpgtfefeyasrwkaldemekqqreqvdrnireakek
    leaemeaarheh