PDB entry 5ifi

View 5ifi on RCSB PDB site
Description: crystal structure of acetyl-coa synthetase in complex with adenosine- 5'-propylphosphate from cryptococcus neoformans h99
Deposited on 2016-02-26, released 2016-03-16
The last revision was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-coenzyme A synthetase
    Species: Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) [TaxId:235443]
    Gene: CNAG_00797
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Acetyl-coenzyme A synthetase
    Species: Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) [TaxId:235443]
    Gene: CNAG_00797
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Acetyl-coenzyme A synthetase
    Species: Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) [TaxId:235443]
    Gene: CNAG_00797
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PRX, EDO, PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ifiA (A:)
    mhhhhhhhhenlyfqgktevapgvhhvhplpdsvpesedlfappprmqgkegrpkphigp
    nyesyvkewaktvgpnsdewwaakaretldwyddfktvraggfehgdvqwfpegtlnaay
    ncldrhyyknpkktaiiyeadepsesrevsyeelmqetcrvanvlksygvkkgdavsiyl
    pmtwqaaaaflacarigaihsavfagfsaeslrdrvndceckvlittdegrrggktiatk
    qivdaalqqcplvenvlvlrrtgnkvpmtegrdkwwdeecakmpaycpcermasedplfi
    lytsgstgkpkgvvhstagyllgtaltlkyvfdahpddrfacmadigwitghsyiiygpl
    angittavfestpvyptpsrywdfvdkwkatqlytaptairllrrmgedhvknhdlsslr
    vlgsvgepinpeawhwyndfagknqcaivdtywmtetgsisiaplpgaistkpgsatfpf
    fgmdvdiidpqtgqvlegndvegvlvarrpwpsiartvyrdhkryletymkpypgyfffg
    dgaardydgymwikgrvddvinvsghrlstaevesalilhkgvaetavvgcaddltgqav
    yafvtmkpefdlkatkeadlskelaiqvrkvigpfaapkkiylvsdlpktrsgkimrrvl
    rkivagegdqlgdlssiadpqiveevkqkvtgsa
    

    Sequence, based on observed residues (ATOM records):
    >5ifiA (A:)
    hhvhplpdsvpesedlfappprmqgkegrpkphigpnyesyvkewaktvgpnsdewwaak
    aretldwyddfktvraggfehgdvqwfpegtlnaayncldrhyyknpkktaiiyeadeps
    esrevsyeelmqetcrvanvlksygvkkgdavsiylpmtwqaaaaflacarigaihsavf
    agfsaeslrdrvndceckvlittdegrrggktiatkqivdaalqqcplvenvlvlrrtgn
    kvpmtegrdkwwdeecakmpaycpcermasedplfilytskpkgvvhstagyllgtaltl
    kyvfdahpddrfacmadigwitghsyiiygplangittavfestpvyptpsrywdfvdkw
    katqlytaptairllrrmgedhvknhdlsslrvlgsvgepinpeawhwyndfagknqcai
    vdtywmtetgsisiaplpgaistkpgsatfpffgmdvdiidpqtgqvlegndvegvlvar
    rpwpsiartvyrdhkryletymkpypgyfffgdgaardydgymwikgrvddvinvsghrl
    staevesalilhkgvaetavvgcaddltgqavyafvtmkpefdlkatkeadlskelaiqv
    rkvigpfaapkkiylvsdlpktrsgkimrrvlrkivagpqiveevkqkvt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ifiB (B:)
    mhhhhhhhhenlyfqgktevapgvhhvhplpdsvpesedlfappprmqgkegrpkphigp
    nyesyvkewaktvgpnsdewwaakaretldwyddfktvraggfehgdvqwfpegtlnaay
    ncldrhyyknpkktaiiyeadepsesrevsyeelmqetcrvanvlksygvkkgdavsiyl
    pmtwqaaaaflacarigaihsavfagfsaeslrdrvndceckvlittdegrrggktiatk
    qivdaalqqcplvenvlvlrrtgnkvpmtegrdkwwdeecakmpaycpcermasedplfi
    lytsgstgkpkgvvhstagyllgtaltlkyvfdahpddrfacmadigwitghsyiiygpl
    angittavfestpvyptpsrywdfvdkwkatqlytaptairllrrmgedhvknhdlsslr
    vlgsvgepinpeawhwyndfagknqcaivdtywmtetgsisiaplpgaistkpgsatfpf
    fgmdvdiidpqtgqvlegndvegvlvarrpwpsiartvyrdhkryletymkpypgyfffg
    dgaardydgymwikgrvddvinvsghrlstaevesalilhkgvaetavvgcaddltgqav
    yafvtmkpefdlkatkeadlskelaiqvrkvigpfaapkkiylvsdlpktrsgkimrrvl
    rkivagegdqlgdlssiadpqiveevkqkvtgsa
    

    Sequence, based on observed residues (ATOM records):
    >5ifiB (B:)
    hhvhplpdsvpesedlfappprmqgkegrpkphigpnyesyvkewaktvgpnsdewwaak
    aretldwyddfktvraggfehgdvqwfpegtlnaayncldrhyyknpkktaiiyeadeps
    esrevsyeelmqetcrvanvlksygvkkgdavsiylpmtwqaaaaflacarigaihsavf
    agfsaeslrdrvndceckvlittdegrrggktiatkqivdaalqqcplvenvlvlrrtgn
    kvpmtegrdkwwdeecakmpaycpcermasedplfilytskpkgvvhstagyllgtaltl
    kyvfdahpddrfacmadigwitghsyiiygplangittavfestpvyptpsrywdfvdkw
    katqlytaptairllrrmgedhvknhdlsslrvlgsvgepinpeawhwyndfagknqcai
    vdtywmtetgsisiaplpgaistkpgsatfpffgmdvdiidpqtgqvlegndvegvlvar
    rpwpsiartvyrdhkryletymkpypgyfffgdgaardydgymwikgrvddvinvsghrl
    staevesalilhkgvaetavvgcaddltgqavyafvtmkpekeadlskelaiqvrkvigp
    faapkkiylvsdlpktrsgkimrrvlrkivapqiveevkqkv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5ifiC (C:)
    mhhhhhhhhenlyfqgktevapgvhhvhplpdsvpesedlfappprmqgkegrpkphigp
    nyesyvkewaktvgpnsdewwaakaretldwyddfktvraggfehgdvqwfpegtlnaay
    ncldrhyyknpkktaiiyeadepsesrevsyeelmqetcrvanvlksygvkkgdavsiyl
    pmtwqaaaaflacarigaihsavfagfsaeslrdrvndceckvlittdegrrggktiatk
    qivdaalqqcplvenvlvlrrtgnkvpmtegrdkwwdeecakmpaycpcermasedplfi
    lytsgstgkpkgvvhstagyllgtaltlkyvfdahpddrfacmadigwitghsyiiygpl
    angittavfestpvyptpsrywdfvdkwkatqlytaptairllrrmgedhvknhdlsslr
    vlgsvgepinpeawhwyndfagknqcaivdtywmtetgsisiaplpgaistkpgsatfpf
    fgmdvdiidpqtgqvlegndvegvlvarrpwpsiartvyrdhkryletymkpypgyfffg
    dgaardydgymwikgrvddvinvsghrlstaevesalilhkgvaetavvgcaddltgqav
    yafvtmkpefdlkatkeadlskelaiqvrkvigpfaapkkiylvsdlpktrsgkimrrvl
    rkivagegdqlgdlssiadpqiveevkqkvtgsa
    

    Sequence, based on observed residues (ATOM records):
    >5ifiC (C:)
    rpkphigpnyesyvkewaktvgpnsdewwaakaretldwyddfktvraggfehgdvqwfp
    egtlnaayncldrhyyknpkktaiiyeadepsesrevsyeelmqetcrvanvlksygvkk
    gdavsiylpmtwqaaaaflacarigaihsavfagfsaeslrdrvndceckvlittdegrr
    ggktiatkqivdaalqqcplvenvlvlrrtgnkvpmtegrdkwwdeecakmpaycpcerm
    asedplfilytskpkgvvhstagyllgtaltlkyvfdahpddrfacmadigwitghsyii
    ygplangittavfestpvyptpsrywdfvdkwkatqlytaptairllrrmgedhvknhdl
    sslrvlgsvgepinpeawhwyndfagknqcaivdtywmtetgsisiaplpgaistkpgsa
    tfpffgmdvdiidpqtgqvlegndvegvlvarrpwpsiartvyrdhkryletymkpypgy
    fffgdgaardydgymwikgrvdinvsghrlstaevesalilhkgvaetavvgcavyafvt
    mkplskelaiqvrkvigpfaapkkiyl