PDB entry 5if9

View 5if9 on RCSB PDB site
Description: Crystal Structure of Cobyrinic Acid a,c-diamide synthase from Mycobacterium smegmatis with bound ATP analog and Magnesium
Class: ligase
Keywords: SSGCID, COBYRINIC ACID A, C-DIAMIDE SYNTHASE, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, LIGASE
Deposited on 2016-02-25, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cobyrinic Acid a,c-diamide synthase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_1927
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QTQ5 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d5if9a1, d5if9a2
  • Chain 'B':
    Compound: Cobyrinic Acid a,c-diamide synthase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_1927
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QTQ5 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d5if9b1, d5if9b2
  • Heterogens: ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5if9A (A:)
    mahhhhhhvtrvlavanqkggvaktttvasigaalteqgrrvllvdldpqgcltfslghd
    pdklpvsvhevllgdvepsaalvrtdegmtllpanidlagaeamllmragreyalkrala
    kldgdfdvviidcppslgvltlngltaahdvivplqcetlahrgvgqflrtisdvqqitn
    pdlkllgalptlydsrtthsrdvlldvadryelpvlappiprtvrfaeasasgssvlagr
    kskgaiayrefadallrhwksgrkmptftpevv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5if9A (A:)
    vtrvlavanqkggvaktttvasigaalteqgrrvllvdldpqgcltfslghdpdklpvsv
    hevllgdvepsaalvrtdegmtllpanidlagaeamllmragreyalkralakldgdfdv
    viidcppslgvltlngltaahdvivplqcetlahrgvgqflrtisdvqqitnpdlkllga
    lptlydsrtthsrdvlldvadryelpvlappiprtsvlagrkskgaiayrefadallrhw
    ksgrkmptftp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5if9B (B:)
    mahhhhhhvtrvlavanqkggvaktttvasigaalteqgrrvllvdldpqgcltfslghd
    pdklpvsvhevllgdvepsaalvrtdegmtllpanidlagaeamllmragreyalkrala
    kldgdfdvviidcppslgvltlngltaahdvivplqcetlahrgvgqflrtisdvqqitn
    pdlkllgalptlydsrtthsrdvlldvadryelpvlappiprtvrfaeasasgssvlagr
    kskgaiayrefadallrhwksgrkmptftpevv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5if9B (B:)
    vtrvlavanqkggvaktttvasigaalteqgrrvllvdldpqgcltfslghdpdklpvsv
    hevllgdvepsaalvrtdegmtllpanidlagaeamllmragreyalkralakldgdfdv
    viidcppslgvltlngltaahdvivplqcetlahrgvgqflrtisdvqqitnpdlkllga
    lptlydsrtthsrdvlldvadryelpvlappiprtkskgaiayrefadallrhwksgrkm
    ptft