PDB entry 5if3

View 5if3 on RCSB PDB site
Description: crystal structure of a short-chain dehydrogenase/reductase sdr from burkholderia vietnamiensis
Deposited on 2016-02-25, released 2016-05-04
The last revision was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_3729
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_3729
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5if3A (A:)
    mahhhhhhmnatacaprvraivtghtrglgaslaeqllqqdiavlgvsrsrhpslaatag
    drlveteldlsdtaavaawlaggalrsfvdgaslvllfnnagvvdpigplaaqdpalvar
    avalnvaaplmlsaalvqaaaaptecrvlhvssgaarnayagwsvycatkaaldhharav
    aldanralricsvapgvvdtgmqatirstseanfpmrekfdalkasgalstpdeaarhli
    ryalsdafgaeptadvrnlpag
    

    Sequence, based on observed residues (ATOM records):
    >5if3A (A:)
    caprvraivtghtrglgaslaeqllqqdiavlgvsrsrhpslaatagdrlveteldlsdt
    aavaawlaggalrsfvdgaslvllfnnagvvdpigplaaqdpalvaravalnvaaplmls
    aalvqaaaaptecrvlhvssgaarnayagwsvycatkaaldhharavaldanralricsv
    apgvvstpdeaarhliryalsdafgaeptadvrnlp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5if3B (B:)
    mahhhhhhmnatacaprvraivtghtrglgaslaeqllqqdiavlgvsrsrhpslaatag
    drlveteldlsdtaavaawlaggalrsfvdgaslvllfnnagvvdpigplaaqdpalvar
    avalnvaaplmlsaalvqaaaaptecrvlhvssgaarnayagwsvycatkaaldhharav
    aldanralricsvapgvvdtgmqatirstseanfpmrekfdalkasgalstpdeaarhli
    ryalsdafgaeptadvrnlpag
    

    Sequence, based on observed residues (ATOM records):
    >5if3B (B:)
    prvraivtghtrglgaslaeqllqqdiavlgvsrsrhpslaatagdrlveteldlsdtaa
    vaawlaggalrsfvdgaslvllfnnagvvdpigplaaqdpalvaravalnvaaplmlsaa
    lvqaaaaptecrvlhvssgaarnayagwsvycatkaaldhharavaldalricsvapgvs
    tpdeaarhliryalsdafgaeptadvrnl