PDB entry 5ieu

View 5ieu on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis atp-independent proteasome activator tetramer
Deposited on 2016-02-25, released 2016-03-30
The last revision was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacterial proteasome activator
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: AFL40_3934
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bacterial proteasome activator
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: AFL40_3934
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ieuA (A:)
    mpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelreeldrltl
    pfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlqqmrqaalehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >5ieuA (A:)
    kvmrigtmikqlleevraapsrnrlrdihatsireledglapelreeldrltlpvpsdae
    lriaqaqlvgwleglfhgiqtalfaqqmaaraqlqqmrq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ieuB (B:)
    mpakvmrigtmikqlleevraapldeasrnrlrdihatsireledglapelreeldrltl
    pfnedavpsdaelriaqaqlvgwleglfhgiqtalfaqqmaaraqlqqmrqaalehhhhh
    h
    

    Sequence, based on observed residues (ATOM records):
    >5ieuB (B:)
    vmrigtmikqlleevraarnrlrdihatsireledglapelreeldrltlpfpsdaelri
    aqaqlvgwleglfhgiqtalfaqqmaaraqlqqmr