PDB entry 5iej

View 5iej on RCSB PDB site
Description: solution structure of the bef3-activated conformation of sdrg from pseudomonas melonis fr1
Deposited on 2016-02-25, released 2016-07-20
The last revision was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SdrG
    Species: Sphingomonas melonis Fr1 [TaxId:1090317]
    Database cross-references and differences (RAF-indexed):
    • PDB 5IEJ (0-End)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5iejA (A:)
    msaltqilivedepliammledflevldktpvgtvdtvagalarvedggidaaildvnlr
    ggekstpvaealaardipfvfatggsddsvdsrfrdrpvlqkpftmdgvakalaallvpr
    gsvehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5iejA (A:)
    msaltqilivedepliammledflevldktpvgtvdtvagalarvedggidaaildvnlr
    ggekstpvaealaardipfvfatggsddsvdsrfrdrpvlqkpftmdgvakalaallv