PDB entry 5ie5

View 5ie5 on RCSB PDB site
Description: crystal structure of a lactonase double mutant in complex with substrate a
Deposited on 2016-02-25, released 2017-01-04
The last revision was dated 2017-01-04, with a file datestamp of 2016-12-30.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zearalenone hydrolase
    Species: Clonostachys rosea [TaxId:29856]
    Gene: zhd101
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NKB0 (0-263)
      • engineered mutation (101)
      • engineered mutation (152)
  • Chain 'B':
    Compound: Zearalenone hydrolase
    Species: Clonostachys rosea [TaxId:29856]
    Gene: zhd101
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NKB0 (0-263)
      • engineered mutation (101)
      • engineered mutation (152)
  • Chain 'C':
    Compound: Zearalenone hydrolase
    Species: Clonostachys rosea [TaxId:29856]
    Gene: zhd101
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NKB0 (Start-263)
      • engineered mutation (101)
  • Heterogens: 36J, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5ie5A (A:)
    mrtrstistpngitwyyeqegtgpdvvlvpdglgecqmfdssvsqiaaqgfrvttfdmpg
    msrsakappetytevtaqklasyvisvldaldikhatvwgcasgastvvalllgypdrir
    namchelptklldhlsntavledeeiskilanhmlndvsggseawqamgdevharlhkny
    pvwargyprtippsapvkdlealrgkpldwtvgaatptesffdnivtatkagvnigllpg
    mhfpyvshpdvfakyvvettqkhl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5ie5B (B:)
    mrtrstistpngitwyyeqegtgpdvvlvpdglgecqmfdssvsqiaaqgfrvttfdmpg
    msrsakappetytevtaqklasyvisvldaldikhatvwgcasgastvvalllgypdrir
    namchelptklldhlsntavledeeiskilanhmlndvsggseawqamgdevharlhkny
    pvwargyprtippsapvkdlealrgkpldwtvgaatptesffdnivtatkagvnigllpg
    mhfpyvshpdvfakyvvettqkhl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5ie5C (C:)
    mrtrstistpngitwyyeqegtgpdvvlvpdglgecqmfdssvsqiaaqgfrvttfdmpg
    msrsakappetytevtaqklasyvisvldaldikhatvwgcasgastvvalllgypdrir
    namchelptklldhlsntavledeeiskilanhmlndvsggseawqamgdevharlhkny
    pvwargyprtippsapvkdlealrgkpldwtvgaatptesffdnivtatkagvnigllpg
    mhfpyvshpdvfakyvvettqkhl
    

    Sequence, based on observed residues (ATOM records):
    >5ie5C (C:)
    istpngitwyyeqegtgpdvvlvpcqmfdssvsqiaaqgfrvfdmappetytevtaqkla
    syvisvldaldikhatvwgcasgastvvalllgypdrirnamcwargyprtippsapvkd
    lealrgkpldaatffdntaagvnlpgmhfdvfakyvvettqkhl