PDB entry 5ie2

View 5ie2 on RCSB PDB site
Description: crystal structure of a plant enzyme
Deposited on 2016-02-24, released 2016-12-07
The last revision was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxalate--CoA ligase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AAE3, 4CLL10, AMPBP3, At3g48990, T2J13.170
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Oxalate--CoA ligase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AAE3, 4CLL10, AMPBP3, At3g48990, T2J13.170
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ATP, MG, ACY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ie2A (A:)
    mdsdtlsgllenvakkfpdrralsvsgkfnltharlhdlieraasrlvsdagikpgdvva
    ltfpntvefvimflavirarataaplnaaytaeefefylsdsdskllltskegnapaqea
    asklkishvtatlldagsdlvlsvadsdsvvdsatelvnhpddgalflhtsgttsrpkgv
    pltqlnlassvknikavykltesdstvivlplfhvhgllagllsslgagaavtlpaagrf
    sattfwpdmkkynatwytavptihqiildrhashpeteypklrfirscsaslapvilsrl
    eeafgapvleayamteathlmssnplpeegphkpgsvgkpvgqemailnekgeiqepnnk
    gevcirgpnvtkgyknnpeankagfefgwfhtgdigyfdtdgylhlvgrikelinrggek
    ispievdavllthpdvsqgvafgvpdekygeeincavipregttvteedikafckknlaa
    fkvpkrvfitdnlpktasgkiqrrivaqhflekp
    

    Sequence, based on observed residues (ATOM records):
    >5ie2A (A:)
    mdsdtlsgllenvakkfpdrralsvsgkfnltharlhdlieraasrlvsdagikpgdvva
    ltfpntvefvimflavirarataaplnaaytaeefefylsdsdskllltskegnapaqea
    asklkishvtatlldagsdlvlsvaddsatelvnhpddgalflhtsgttsrpkgvpltql
    nlassvknikavykltesdstvivlplfhvhgllagllsslgagaavtlpaagrfsattf
    wpdmkkynatwytavptihqiildrhashpeteypklrfirscsaslapvilsrleeafg
    apvleayamteathlmssnplpeegphkpgsvgkpvgqemailnekgeiqepnnkgevci
    rgpnvtkgyknnpeankagfefgwfhtgdigyfdtdgylhlvgrikelinrggekispie
    vdavllthpdvsqgvafgvpdekygeeincavipregttvteedikafckknlaafkvpk
    rvfitdnlpktasgkiqrrivaqhfl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ie2B (B:)
    mdsdtlsgllenvakkfpdrralsvsgkfnltharlhdlieraasrlvsdagikpgdvva
    ltfpntvefvimflavirarataaplnaaytaeefefylsdsdskllltskegnapaqea
    asklkishvtatlldagsdlvlsvadsdsvvdsatelvnhpddgalflhtsgttsrpkgv
    pltqlnlassvknikavykltesdstvivlplfhvhgllagllsslgagaavtlpaagrf
    sattfwpdmkkynatwytavptihqiildrhashpeteypklrfirscsaslapvilsrl
    eeafgapvleayamteathlmssnplpeegphkpgsvgkpvgqemailnekgeiqepnnk
    gevcirgpnvtkgyknnpeankagfefgwfhtgdigyfdtdgylhlvgrikelinrggek
    ispievdavllthpdvsqgvafgvpdekygeeincavipregttvteedikafckknlaa
    fkvpkrvfitdnlpktasgkiqrrivaqhflekp
    

    Sequence, based on observed residues (ATOM records):
    >5ie2B (B:)
    mdsdtlsgllenvakkfpdrralsvsgkfnltharlhdlieraasrlvsdagikpgdvva
    ltfpntvefvimflavirarataaplnaaytaeefefylsdsdskllltskegnapaqea
    asklkishvtatlldagsdlvlsvaddsatelvnhpddgalflhtsgttsrpkgvpltql
    nlassvknikavykltesdstvivlplfhvhgllagllsslgagaavtlpaagrfsattf
    wpdmkkynatwytavptihqiildrhashpeteypklrfirscsaslapvilsrleeafg
    apvleayamteathlmssnplpeegphkpgsvgkpvgqemailnekgeiqepnnkgevci
    rgpnvtkgyknnpeankagfefgwfhtgdigyfdtdgylhlvgrikelinrggekispie
    vdavllthpdvsqgvafgvpdekygeeincavipregttvteedikafckknlaafkvpk
    rvfitdnlpktasgkiqrrivaqhfl