PDB entry 5idz

View 5idz on RCSB PDB site
Description: Structure of Human Enolase 2 in complex with (S)-(1-hydroxy-2-oxopiperidin-3-yl)phosphonate
Class: lyase/lyase inhibitor
Keywords: enolase gamma, glycolysis, neuron specific enolase, carbohydrate metabolism, LYASE-LYASE INHIBITOR complex
Deposited on 2016-02-24, released 2017-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 2.63 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09104 (0-433)
      • expression tag (434-435)
    Domains in SCOPe 2.08: d5idza1, d5idza2, d5idza3
  • Chain 'B':
    Compound: Gamma-enolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ENO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5idzb1, d5idzb2
  • Heterogens: MG, 6BM, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5idzA (A:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5idzA (A:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5idzB (B:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5idzB (B:)
    msiekiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgk
    gvlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavck
    agaaerelplyrhiaqlagnsdlilpvpafnvinggshagnklamqefmilpvgaesfrd
    amrlgaevyhtlkgvikdkygkdatnvgdeggfapnilensealelvkeaidkagyteki
    vigmdvaasefyrdgkydldfksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqdd
    waawskftanvgiqivgddltvtnpkrieraveekacnclllkvnqigsvteaiqackla
    qengwgvmvshrsgetedtfiadlvvglctgqiktgapcrserlakynqlmrieeelgde
    arfaghnfrnpsvl