PDB entry 5idy

View 5idy on RCSB PDB site
Description: Crystal structure of an oxidoreductase from Burkholderia vietnamiensis in complex with NADP
Class: oxidoreductase
Keywords: SSGCID, oxidoreductase, short chain dehydrogenase/reductase family, NADP, Burkholderia vietnamiensis, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2016-02-24, released 2016-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_2377
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4JGH3 (8-266)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d5idya1, d5idya2
  • Chain 'B':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_2377
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4JGH3 (8-266)
      • expression tag (3-7)
    Domains in SCOPe 2.07: d5idyb1, d5idyb2
  • Heterogens: SO4, EDO, CL, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5idyA (A:)
    mahhhhhhmdlgiagktalvcaaskglgrgcaealaaegvnlvivartrdtlertadeir
    aasnvsvatvacdittpdgraaalaacpqpdilvnnaggpppgdfrdfshddwiralesn
    mltpieliratvdgmiargfgrivnitssavkapidvlalsngarsgltgfvaglarkvv
    gqgvtinnllpglfdtdriattlaaaanaqgvtvdelrarrtrdipagrlgtraefgaac
    aflcsvhagyitgqnwlldggaypgtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5idyA (A:)
    hhhmdlgiagktalvcaaskglgrgcaealaaegvnlvivartrdtlertadeiraasnv
    svatvacdittpdgraaalaacpqpdilvnnaggpppgdfrdfshddwiralesnmltpi
    eliratvdgmiargfgrivnitssavkapidvlalsngarsgltgfvaglarkvvgqgvt
    innllpglfdtdriattlaaaanaqgvtvdelrarrtrdipagrlgtraefgaacaflcs
    vhagyitgqnwlldggaypgtf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5idyB (B:)
    mahhhhhhmdlgiagktalvcaaskglgrgcaealaaegvnlvivartrdtlertadeir
    aasnvsvatvacdittpdgraaalaacpqpdilvnnaggpppgdfrdfshddwiralesn
    mltpieliratvdgmiargfgrivnitssavkapidvlalsngarsgltgfvaglarkvv
    gqgvtinnllpglfdtdriattlaaaanaqgvtvdelrarrtrdipagrlgtraefgaac
    aflcsvhagyitgqnwlldggaypgtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5idyB (B:)
    hhhhhmdlgiagktalvcaaskglgrgcaealaaegvnlvivartrdtlertadeiraas
    nvsvatvacdittpdgraaalaacpqpdilvnnaggpppgdfrdfshddwiralesnmlt
    pieliratvdgmiargfgrivnitssavkapidvlalsngarsgltgfvaglarkvvgqg
    vtinnllpglfdtdriattlaaaanaqgvtvdelrarrtrdipagrlgtraefgaacafl
    csvhagyitgqnwlldggaypgtf