PDB entry 5idw

View 5idw on RCSB PDB site
Description: Crystal structure of an oxidoreductase from Burkholderia vietnamiensis in complex with NADP
Class: oxidoreductase
Keywords: SSGCID, oxidoreductase, short chain dehydrogenase/reductase family, NADP, Brucella ovis, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2016-02-24, released 2016-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_3023
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5idwa_
  • Chain 'B':
    Compound: Short-chain dehydrogenase/reductase SDR
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_3023
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5idwb_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5idwA (A:)
    mahhhhhhmktvlivgasrglgrefvrqyrrdgwnviatarddaslaalraagahahald
    iaqpeqiaalgwkldgerldaavlvsgvygprtegvetignedfdavmhtnvrgpmqllp
    ivlplvedargvlavvssrmgsiadatgttgwlyraskaalndvlriaslqtrhaacisl
    hpgwvrtdmggaeaaidpetsvtgmrrviaeagadvsrangrflqydgvelsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5idwA (A:)
    mktvlivgasrglgrefvrqyrrdgwnviatarddaslaalraagahahaldiaqpeqia
    algwkldgerldaavlvsgvygprtegvetignedfdavmhtnvrgpmqllpivlplved
    argvlavvssrmgsiadatgttgwlyraskaalndvlriaslqtrhaacislhpgwvrtd
    mggaeaaidpetsvtgmrrviaeagadvsrangrflqydgvelsw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5idwB (B:)
    mahhhhhhmktvlivgasrglgrefvrqyrrdgwnviatarddaslaalraagahahald
    iaqpeqiaalgwkldgerldaavlvsgvygprtegvetignedfdavmhtnvrgpmqllp
    ivlplvedargvlavvssrmgsiadatgttgwlyraskaalndvlriaslqtrhaacisl
    hpgwvrtdmggaeaaidpetsvtgmrrviaeagadvsrangrflqydgvelsw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5idwB (B:)
    mktvlivgasrglgrefvrqyrrdgwnviatarddaslaalraagahahaldiaqpeqia
    algwkldgerldaavlvsgvygprtegvetignedfdavmhtnvrgpmqllpivlplved
    argvlavvssrmgsiadatgttgwlyraskaalndvlriaslqtrhaacislhpgwvrtd
    mggaeaaidpetsvtgmrrviaeagadvsrangrflqydgvelsw