PDB entry 5idt

View 5idt on RCSB PDB site
Description: Crystal Structure of a Glucose-1-phosphate Thymidylyltransferase from Burkholderia vietnamiensis with bound Thymidine
Class: transferase
Keywords: SSGCID, Glucose-1-phosphate thymidylyltransferase, Burkholderia vietnamiensis, Nucleotidyltransferase, Transferase, Thymidine, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease
Deposited on 2016-02-24, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-09, with a file datestamp of 2016-03-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose-1-phosphate thymidylyltransferase
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_3215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5idta_
  • Chain 'B':
    Compound: glucose-1-phosphate thymidylyltransferase
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_3215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5idtb_
  • Chain 'C':
    Compound: glucose-1-phosphate thymidylyltransferase
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_3215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5idtc_
  • Chain 'D':
    Compound: glucose-1-phosphate thymidylyltransferase
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_3215
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5idtd_
  • Heterogens: THM, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5idtA (A:)
    mahhhhhhmtqrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagmrdv
    lvistpqdtprfqqllgdgsqwgmnlqyavqpspdglaqafiigeqfignapsalvlgdn
    iyyghdfqpllkaadaqssgatvfayhvhdperygvvqfnaqgqavsieekpkapksnya
    vtglyfydqqvvdiakavkpsargeleitsvnqaymqqgqlnvqtmgrgyawldtgthds
    lldasqfiatlenrqglkvacpeeiawrsgwinasqlealvqpltkngygqylmqilket
    vf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5idtA (A:)
    tqrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagmrdvlvistpqdt
    prfqqllgdgsqwgmnlqyavqpspdglaqafiigeqfignapsalvlgdniyyghdfqp
    llkaadaqssgatvfayhvhdperygvvqfnaqgqavsieekpkapksnyavtglyfydq
    qvvdiakavkpsargeleitsvnqaymqqgqlnvqtmgrgyawldtgthdslldasqfia
    tlenrqglkvacpeeiawrsgwinasqlealvqpltkngygqylmqilk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5idtB (B:)
    mahhhhhhmtqrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagmrdv
    lvistpqdtprfqqllgdgsqwgmnlqyavqpspdglaqafiigeqfignapsalvlgdn
    iyyghdfqpllkaadaqssgatvfayhvhdperygvvqfnaqgqavsieekpkapksnya
    vtglyfydqqvvdiakavkpsargeleitsvnqaymqqgqlnvqtmgrgyawldtgthds
    lldasqfiatlenrqglkvacpeeiawrsgwinasqlealvqpltkngygqylmqilket
    vf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5idtB (B:)
    tqrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagmrdvlvistpqdt
    prfqqllgdgsqwgmnlqyavqpspdglaqafiigeqfignapsalvlgdniyyghdfqp
    llkaadaqssgatvfayhvhdperygvvqfnaqgqavsieekpkapksnyavtglyfydq
    qvvdiakavkpsargeleitsvnqaymqqgqlnvqtmgrgyawldtgthdslldasqfia
    tlenrqglkvacpeeiawrsgwinasqlealvqpltkngygqylmqilk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5idtC (C:)
    mahhhhhhmtqrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagmrdv
    lvistpqdtprfqqllgdgsqwgmnlqyavqpspdglaqafiigeqfignapsalvlgdn
    iyyghdfqpllkaadaqssgatvfayhvhdperygvvqfnaqgqavsieekpkapksnya
    vtglyfydqqvvdiakavkpsargeleitsvnqaymqqgqlnvqtmgrgyawldtgthds
    lldasqfiatlenrqglkvacpeeiawrsgwinasqlealvqpltkngygqylmqilket
    vf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5idtC (C:)
    tqrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagmrdvlvistpqdt
    prfqqllgdgsqwgmnlqyavqpspdglaqafiigeqfignapsalvlgdniyyghdfqp
    llkaadaqssgatvfayhvhdperygvvqfnaqgqavsieekpkapksnyavtglyfydq
    qvvdiakavkpseleitsvnqaymqqgqlnvqtmgrgyawldtgthdslldasqfiatle
    nrqglkvacpeeiawrsgwinasqlealvqpltkngygqylmqilk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5idtD (D:)
    mahhhhhhmtqrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagmrdv
    lvistpqdtprfqqllgdgsqwgmnlqyavqpspdglaqafiigeqfignapsalvlgdn
    iyyghdfqpllkaadaqssgatvfayhvhdperygvvqfnaqgqavsieekpkapksnya
    vtglyfydqqvvdiakavkpsargeleitsvnqaymqqgqlnvqtmgrgyawldtgthds
    lldasqfiatlenrqglkvacpeeiawrsgwinasqlealvqpltkngygqylmqilket
    vf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5idtD (D:)
    tqrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagmrdvlvistpqdt
    prfqqllgdgsqwgmnlqyavqpspdglaqafiigeqfignapsalvlgdniyyghdfqp
    llkaadaqssgatvfayhvhdperygvvqfnaqgqavsieekpkapksnyavtglyfydq
    qvvdiakavkpsargeleitsvnqaymqqgqlnvqtmgrgyawldtgthdslldasqfia
    tlenrqglkvacpeeiawrsgwinasqlealvqpltkngygqylmqilk