PDB entry 5idj

View 5idj on RCSB PDB site
Description: bifunctional histidine kinase ccka (domains dhp-ca) in complex with adp/mg2+
Deposited on 2016-02-24, released 2016-10-05
The last revision was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell cycle histidine kinase CckA
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: cckA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X688 (0-241)
      • conflict (33)
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5idjA (A:)
    lsqaqkmqaigqlaggvahdfnnlltaiqlrldqllhrhpvgdpsyeglneirqtgvraa
    dlvrkllafsrkqtvqrevldlgelisefevllrrllredvklitdygrdlpqvradksq
    letavmnlavnardavraakgggvvrirtarltrdeaiqlgfpaadgdtafievsddgpg
    ippdvmgkifdpffttkpvgegtglglatvygivkqsdgwihvhsrpnegaafriflpvy
    ea