PDB entry 5idi

View 5idi on RCSB PDB site
Description: Structure of beta glucosidase 1A from Thermotoga neapolitana, mutant E349A
Class: hydrolase
Keywords: beta-glucosidase, glycosyl hydrolase family 1, hydrolase
Deposited on 2016-02-24, released 2017-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-beta-D-glucan glucohydrolase
    Species: Thermotoga neapolitana [TaxId:2337]
    Gene: gghA, CTN_0782
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9K7M5 (0-End)
      • conflict (164)
      • engineered mutation (348)
    Domains in SCOPe 2.06: d5idia_
  • Chain 'B':
    Compound: 1,4-beta-D-glucan glucohydrolase
    Species: Thermotoga neapolitana [TaxId:2337]
    Gene: gghA, CTN_0782
    Database cross-references and differences (RAF-indexed):
    • Uniprot B9K7M5 (0-443)
      • conflict (164)
      • engineered mutation (348)
    Domains in SCOPe 2.06: d5idib_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5idiA (A:)
    mkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
    edieiiekigakayrfsiswprilpegtgkvnqkgldfynriidtlleknitpfitiyhw
    dlpfslqlkggwanrdiadwfaeysrvlfenfgdrvkhwitlnelwvvaivghlygvhap
    gmkdiyvafhtvhnllrahaksvkvfretvkdgkigivfnngyfepasereediraarfm
    hqfnnyplflnpiyrgeypdlvlefareylprnyeddmeeikqeidfvglnyysghmvky
    dpnsparvsfvernlpktamgweivpegiywilkgvkeeynpqevyitgngaafddvvse
    ggkvhdqnridylrahieqvwraiqdgvplkgyfvwslldnfewaegyskrfgivyvdyn
    tqkriikdsgywysnviknngltdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5idiA (A:)
    mkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
    edieiiekigakayrfsiswprilpegtgkvnqkgldfynriidtlleknitpfitiyhw
    dlpfslqlkggwanrdiadwfaeysrvlfenfgdrvkhwitlnelwvvaivghlygvhap
    gmkdiyvafhtvhnllrahaksvkvfretvkdgkigivfnngyfepasereediraarfm
    hqfnnyplflnpiyrgeypdlvlefareylprnyeddmeeikqeidfvglnyysghmvky
    dpnsparvsfvernlpktamgweivpegiywilkgvkeeynpqevyitgngaafddvvse
    ggkvhdqnridylrahieqvwraiqdgvplkgyfvwslldnfewaegyskrfgivyvdyn
    tqkriikdsgywysnviknnglt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5idiB (B:)
    mkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
    edieiiekigakayrfsiswprilpegtgkvnqkgldfynriidtlleknitpfitiyhw
    dlpfslqlkggwanrdiadwfaeysrvlfenfgdrvkhwitlnelwvvaivghlygvhap
    gmkdiyvafhtvhnllrahaksvkvfretvkdgkigivfnngyfepasereediraarfm
    hqfnnyplflnpiyrgeypdlvlefareylprnyeddmeeikqeidfvglnyysghmvky
    dpnsparvsfvernlpktamgweivpegiywilkgvkeeynpqevyitgngaafddvvse
    ggkvhdqnridylrahieqvwraiqdgvplkgyfvwslldnfewaegyskrfgivyvdyn
    tqkriikdsgywysnviknngltdlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5idiB (B:)
    mkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
    edieiiekigakayrfsiswprilpegtgkvnqkgldfynriidtlleknitpfitiyhw
    dlpfslqlkggwanrdiadwfaeysrvlfenfgdrvkhwitlnelwvvaivghlygvhap
    gmkdiyvafhtvhnllrahaksvkvfretvkdgkigivfnngyfepasereediraarfm
    hqfnnyplflnpiyrgeypdlvlefareylprnyeddmeeikqeidfvglnyysghmvky
    dpnsparvsfvernlpktamgweivpegiywilkgvkeeynpqevyitgngaafddvvse
    ggkvhdqnridylrahieqvwraiqdgvplkgyfvwslldnfewaegyskrfgivyvdyn
    tqkriikdsgywysnviknngltd