PDB entry 5ide

View 5ide on RCSB PDB site
Description: cryo-em structure of glua2/3 ampa receptor heterotetramer (model i)
Deposited on 2016-02-24, released 2016-03-16
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: EM
Resolution: 8.25 Å
R-factor: N/A
AEROSPACI score: -0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491
      • engineered mutation (301)
  • Chain 'B':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria3, Glur3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19492
      • engineered mutation (272)
      • engineered mutation (446)
  • Chain 'C':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491
      • engineered mutation (301)
  • Chain 'D':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria3, Glur3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19492
      • engineered mutation (272)
      • engineered mutation (446)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ideA (A:)
    veqkliseedlssnsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansf
    avtnafcsqfsrgvyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpd
    lkgallslieyyqwdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdet
    yrslfqdlelkkerrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiq
    fgganvsgfqivdyddslvskfierwstleekeypgahtatikytsaltydavqvmteaf
    rclrkqrieisrrgnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkriny
    tinimelktngprkigywsevdkmvvtltelpsgndtsglenktvvvttilespyvmmkk
    nhemlegneryegycvdlaaeiakhcgfkykltivgdgkygardadtkiwngmvgelvyg
    kadiaiapltitlvreevidfskpfmslgisimikkpqkskpgvfsfldplayeiwmciv
    fayigvsvvlflvsrfspyewhteefedgretqssestnefgifnslwfslgafmqqgcd
    isprslsgrivggvwwfftliiissytanlaafltvermvspiesaedlskqteiaygtl
    dsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskgkyayllestmne
    yieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlklseqgvldklknkwwydk
    gecgakdsgskektsalslsnvagvfyilvgglglamlvaliefcyksraeakrmkvakn
    pqninpsssqnsqnfatykegynvygiesvki
    

    Sequence, based on observed residues (ATOM records):
    >5ideA (A:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrclrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvvtlttvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcg
    fkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfms
    lgisimikskpgvfsfldplayeiwmcivfayigvsvvlflvsprslsgrivggvwwfft
    liiissytanlaafltvermpiesaedlskqteiaygtldsgstkeffrrskiavfdkmw
    tymrsaepsvfvrttaegvarvrkskgkyayllestmneyieqrkpcdtmkvggnldskg
    ygiatpkgsslgtpvnlavlklseqgvldklknkwwydkgecsalslsnvagvfyilvgg
    lglamlvaliefcyk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ideB (B:)
    gdykddddkfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhlds
    snsfsvtnafcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviq
    mrpalkgailsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvq
    efrriieemdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillerv
    mhgganitgfqivnnenpmvqqfiqrwvrldecefpeaknaplkytsalthdailviaea
    frylrrqrvdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtn
    ytidvyemkvsgsrkagywneyerfvpfsdqqisndssssenrtivvttilespyvmykk
    nheqlegneryegycvdlayeiakhvgikyklsivgdgkygardpetkiwngmvgelvyg
    radiavapltitlvreevidfskpfmslgisimikkpqkskpgvfsfldplayeiwmciv
    fayigvsvvlflvsrfspyewhlednneeprdpqsppdppnefgifnslwfslgafmqqg
    cdisprslsgrivggvwwfftliiissytanlaafltvermvspiesaedlakqteiayg
    tldsgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrkskgkfafllestm
    neyieqrkpcdtmkvggnldskgygvatpkgsalgtpvnlavlklseqgildklknkwwy
    dkgecgakdsgskdktsalslsnvagvfyilvgglglammvaliefcyksraeskrmklt
    kntqnfkpapatntqnyatyregynvygtesvki
    

    Sequence, based on observed residues (ATOM records):
    >5ideB (B:)
    ntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtnafc
    sqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgails
    llsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieemdr
    rqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitgfq
    ivnnenpmvqqfiqrwvrldecefpeaknaplkytsalthdailviaeafrylrrqrvdv
    srsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemkvsgs
    rkagywneyerfvpftivvttilespyvmykknheqlegneryegycvdlayeiakhvgi
    kyklsivgdgkygardpetkiwngmvgelvygradiavapltitlvreevidfskpfmsl
    gisimikgvfsfldplayeiwmcivfayigvsvvlflvsprslsgrivggvwwfftliii
    ssytanlaafltvermiesaedlakqteiaygtldsgstkeffrrskiavyekmwsymks
    aepsvftkttadgvarvrkskgkfafllestmneyieqrkpcdtmkvggnldskgygvat
    pkgsalgtpvnlavlklseqgildklknkwwydkgecktsalslsnvagvfyilvgglgl
    ammvaliefcyk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5ideC (C:)
    veqkliseedlssnsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansf
    avtnafcsqfsrgvyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpd
    lkgallslieyyqwdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdet
    yrslfqdlelkkerrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiq
    fgganvsgfqivdyddslvskfierwstleekeypgahtatikytsaltydavqvmteaf
    rclrkqrieisrrgnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkriny
    tinimelktngprkigywsevdkmvvtltelpsgndtsglenktvvvttilespyvmmkk
    nhemlegneryegycvdlaaeiakhcgfkykltivgdgkygardadtkiwngmvgelvyg
    kadiaiapltitlvreevidfskpfmslgisimikkpqkskpgvfsfldplayeiwmciv
    fayigvsvvlflvsrfspyewhteefedgretqssestnefgifnslwfslgafmqqgcd
    isprslsgrivggvwwfftliiissytanlaafltvermvspiesaedlskqteiaygtl
    dsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrkskgkyayllestmne
    yieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlklseqgvldklknkwwydk
    gecgakdsgskektsalslsnvagvfyilvgglglamlvaliefcyksraeakrmkvakn
    pqninpsssqnsqnfatykegynvygiesvki
    

    Sequence, based on observed residues (ATOM records):
    >5ideC (C:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrclrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvvtlttvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcg
    fkykltivgdgkygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfms
    lgisimikkkskpgvfsfldplayeiwmcivfayigvsvvlflvsprslsgrivggvwwf
    ftliiissytanlaafltvermpiesaedlskqteiaygtldsgstkeffrrskiavfdk
    mwtymrsaepsvfvrttaegvarvrkskgkyayllestmneyieqrkpcdtmkvggnlds
    kgygiatpkgsslgtpvnlavlklseqgvldklknkwwydkgectsalslsnvagvfyil
    vgglglamlvaliefcyk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5ideD (D:)
    gdykddddkfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhlds
    snsfsvtnafcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviq
    mrpalkgailsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvq
    efrriieemdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillerv
    mhgganitgfqivnnenpmvqqfiqrwvrldecefpeaknaplkytsalthdailviaea
    frylrrqrvdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtn
    ytidvyemkvsgsrkagywneyerfvpfsdqqisndssssenrtivvttilespyvmykk
    nheqlegneryegycvdlayeiakhvgikyklsivgdgkygardpetkiwngmvgelvyg
    radiavapltitlvreevidfskpfmslgisimikkpqkskpgvfsfldplayeiwmciv
    fayigvsvvlflvsrfspyewhlednneeprdpqsppdppnefgifnslwfslgafmqqg
    cdisprslsgrivggvwwfftliiissytanlaafltvermvspiesaedlakqteiayg
    tldsgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrkskgkfafllestm
    neyieqrkpcdtmkvggnldskgygvatpkgsalgtpvnlavlklseqgildklknkwwy
    dkgecgakdsgskdktsalslsnvagvfyilvgglglammvaliefcyksraeskrmklt
    kntqnfkpapatntqnyatyregynvygtesvki
    

    Sequence, based on observed residues (ATOM records):
    >5ideD (D:)
    ntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtnafc
    sqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgails
    llsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieemdr
    rqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitgfq
    ivnnenpmvqqfiqrwvrldecefpeaknaplkytsalthdailviaeafrylrrqrvdv
    srsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemkvsgs
    rkagywneyerfvpftivvttilespyvmykknheqlegneryegycvdlayeiakhvgi
    kyklsivgdgkygardpetkiwngmvgelvygradiavapltitlvreevidfskpfmsl
    gisimikgvfsfldplayeiwmcivfayigvsvvlflvsprslsgrivggvwwfftliii
    ssytanlaafltvermiesaedlakqteiaygtldsgstkeffrrskiavyekmwsymks
    aepsvftkttadgvarvrkskgkfafllestmneyieqrkpcdtmkvggnldskgygvat
    pkgsalgtpvnlavlklseqgildklknkwwydkgecktsalslsnvagvfyilvgglgl
    ammvaliefcyk