PDB entry 5id4

View 5id4 on RCSB PDB site
Description: crystal structure of proteus mirabilis scsc in an extended conformation
Deposited on 2016-02-23, released 2017-07-26
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DsbA-like protein
    Species: Proteus mirabilis ATCC 29906 [TaxId:525369]
    Gene: HMPREF0693_3732
    Database cross-references and differences (RAF-indexed):
    • Uniprot C2LPE2 (2-End)
      • expression tag (1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5id4A (A:)
    snaalnaaqekevralvrdtlvsnpeileeaimalqtkkadeqqaqfrqalasehdalyn
    daasprigakdaklvlvsftdyncpyckrfdpllekiteqypdvaviikplpfkgessak
    asqavlsvwkedpkaflalhqrlmqkktmldnasiedamkstntskikltddslktlqnn
    lelsrklgiqgtpatvigdtilpgavdydqleiivkeqlakvkk
    

    Sequence, based on observed residues (ATOM records):
    >5id4A (A:)
    naalnaaqekevralvrdtlvsnpeileeaimalqtkkadeqqaqfrqalasehdalynd
    aasprigakdaklvlvsftdyncpyckrfdpllekiteqypdvaviikplpfkgessaka
    sqavlsvwkedpkaflalhqrlmqkktmldnasiedamkstntskikltddslktlqnnl
    elsrklgiqgtpatvigdtilpgavdydqleiivkeqlakv