PDB entry 5icw

View 5icw on RCSB PDB site
Description: crystal structure of human natf (hnaa60) homodimer bound to coenzyme a
Deposited on 2016-02-23, released 2016-06-22
The last revision was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-alpha-acetyltransferase 60
    Species: Homo sapiens [TaxId:9606]
    Gene: NAA60, HAT4, NAT15, UNQ2771/PRO7155
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: N-alpha-acetyltransferase 60
    Species: Homo sapiens [TaxId:9606]
    Gene: NAA60, HAT4, NAT15, UNQ2771/PRO7155
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: N-alpha-acetyltransferase 60
    Species: Homo sapiens [TaxId:9606]
    Gene: NAA60, HAT4, NAT15, UNQ2771/PRO7155
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: N-alpha-acetyltransferase 60
    Species: Homo sapiens [TaxId:9606]
    Gene: NAA60, HAT4, NAT15, UNQ2771/PRO7155
    Database cross-references and differences (RAF-indexed):
  • Heterogens: COA, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5icwA (A:)
    evvpssalsevslrllchddidtvkhlcgdwfpieypdswyrditsnkkffslaatyrga
    ivgmivaeiknrtkihkedgdilasnfsvdtqvayilslgvvkefrkhgigsllleslkd
    histtaqdhckaiylhvlttnntainfyenrdfkqhhylpyyysirgvlkdgftyvlyin
    gg
    

    Sequence, based on observed residues (ATOM records):
    >5icwA (A:)
    vpssalsevslrllchddidtvkhlcgdwfpieypdswyrditsnkkffslaatyrgaiv
    gmivaeiknrtkihkedgdilasnfsvdtqvayilslgvvkefrkhgigsllleslkdhi
    sttaqdhckaiylhvlttnntainfyenrdfkqhhylpyyysirgvlkdgftyvlyingg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5icwB (B:)
    evvpssalsevslrllchddidtvkhlcgdwfpieypdswyrditsnkkffslaatyrga
    ivgmivaeiknrtkihkedgdilasnfsvdtqvayilslgvvkefrkhgigsllleslkd
    histtaqdhckaiylhvlttnntainfyenrdfkqhhylpyyysirgvlkdgftyvlyin
    gg
    

    Sequence, based on observed residues (ATOM records):
    >5icwB (B:)
    vpssalsevslrllchddidtvkhlcgdwfpieypdswyrditsnkkffslaatyrgaiv
    gmivaeiknrtkihkedgdilasnfsvdtqvayilslgvvkefrkhgigsllleslkdhi
    sttaqdhckaiylhvlttnntainfyenrdfkqhhylpyyysirgvlkdgftyvlyingg
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5icwC (C:)
    evvpssalsevslrllchddidtvkhlcgdwfpieypdswyrditsnkkffslaatyrga
    ivgmivaeiknrtkihkedgdilasnfsvdtqvayilslgvvkefrkhgigsllleslkd
    histtaqdhckaiylhvlttnntainfyenrdfkqhhylpyyysirgvlkdgftyvlyin
    gg
    

    Sequence, based on observed residues (ATOM records):
    >5icwC (C:)
    evvpssalsevslrllchddidtvkhlcgdwfpieypdswyrditsnkkffslaatyrga
    ivgmivaeiknrtkihkedgdilsvdtqvayilslgvvkefrkhgigsllleslkdhist
    taqdhckaiylhvlttnntainfyenrdfkqhhylpyyysirgvlkdgftyvlyin
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5icwD (D:)
    evvpssalsevslrllchddidtvkhlcgdwfpieypdswyrditsnkkffslaatyrga
    ivgmivaeiknrtkihkedgdilasnfsvdtqvayilslgvvkefrkhgigsllleslkd
    histtaqdhckaiylhvlttnntainfyenrdfkqhhylpyyysirgvlkdgftyvlyin
    gg
    

    Sequence, based on observed residues (ATOM records):
    >5icwD (D:)
    vpssalsevslrllchddidtvkhlcgdwfpieypdswyrditsnkkffslaatyrgaiv
    gmivaeiknrtkihkedgdilasvdtqvayilslgvvkefrkhgigsllleslkdhistt
    aqdhckaiylhvlttnntainfyenrdfkqhhylpyyysirgvlkdgftyvlying