PDB entry 5icv

View 5icv on RCSB PDB site
Description: Crystal structure of human NatF (hNaa60) bound to a bisubstrate analogue
Class: transferase
Keywords: Transferase, Acetylation, GNAT, NAT
Deposited on 2016-02-23, released 2016-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-alpha-acetyltransferase 60
    Species: Homo sapiens [TaxId:9606]
    Gene: NAA60, HAT4, NAT15, UNQ2771/PRO7155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5icva_
  • Chain 'B':
    Compound: N-alpha-acetyltransferase 60
    Species: Homo sapiens [TaxId:9606]
    Gene: NAA60, HAT4, NAT15, UNQ2771/PRO7155
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5icvb_
  • Chain 'C':
    Compound: met-lys-ala-val-lig
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ICV (0-3)
  • Chain 'D':
    Compound: met-lys-ala-val-lig
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ICV (0-3)
  • Heterogens: 1XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5icvA (A:)
vpssalsevslrllchddidtvkhlcgdwfpieypdswyrditsnkkffslaatyrgaiv
gmivaeiknrtkihkedgdilasnfsvdtqvayilslgvvkefrkhgigsllleslkdhi
sttaqdhckaiylhvlttnntainfyenrdfkqhhylpyyysirgvlkdgftyvlyingg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5icvB (B:)
vpssalsevslrllchddidtvkhlcgdwfpieypdswyrditsnkkffslaatyrgaiv
gmivaeiknrtkihkedgdilasnfsvdtqvayilslgvvkefrkhgigsllleslkdhi
sttaqdhckaiylhvlttnntainfyenrdfkqhhylpyyysirgvlkdgftyvlyingg

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.