PDB entry 5icn

View 5icn on RCSB PDB site
Description: hdac1:mta1 in complex with inositol-6-phosphate and a novel peptide inhibitor based on histone h4
Deposited on 2016-02-23, released 2016-05-11
The last revision was dated 2020-10-07, with a file datestamp of 2020-10-02.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metastasis-associated protein mta1
    Species: Homo sapiens [TaxId:9606]
    Gene: MTA1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histone deacetylase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HDAC1, RPD3L1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: gly-ala-6a0-arg-his
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ICN (Start-8)
  • Heterogens: IHP, ZN, K

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5icnA (A:)
    gaadkgeirvgnryqaditdllkegeedgrdqsrletqvweahnpltdkqidqflvvars
    vgtfaraldcsssvrqpslhmsaaaasrditlfhamdtlhkniydiskaisalvpqggpv
    lcrdemeewsaseanlfeealekygkdftdiqqdflpwksltsiieyyymwkttdryvqq
    krlkaaeaesklkqv
    

    Sequence, based on observed residues (ATOM records):
    >5icnA (A:)
    geirvgnryqaditdllkegeedgrdqsrletqvweahnpltdkqidqflvvarsvgtfa
    raldslhmsaaaasrditlfhamdtlhkniydiskaisalvpqggpvlcrdemeewsase
    anlfeealekygkdftdiqqdflpwksltsiieyyymwkttdryvqqk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5icnB (B:)
    maqtqgtrrkvcyyydgdvgnyyygqghpmkphrirmthnlllnyglyrkmeiyrphkan
    aeemtkyhsddyikflrsirpdnmseyskqmqrfnvgedcpvfdglfefcqlstggsvas
    avklnkqqtdiavnwagglhhakkseasgfcyvndivlailellkyhqrvlyididihhg
    dgveeafyttdrvmtvsfhkygeyfpgtgdlrdigagkgkyyavnyplrdgiddesyeai
    fkpvmskvmemfqpsavvlqcgsdslsgdrlgcfnltikghakcvefvksfnlpmlmlgg
    ggytirnvarcwtyetavaldteipnelpyndyfeyfgpdfklhispsnmtnqntneyle
    kikqrlfenlrmlpha
    

    Sequence, based on observed residues (ATOM records):
    >5icnB (B:)
    rrkvcyyydgdvgnyyygqghpmkphrirmthnlllnyglyrkmeiyrphkanaeemtky
    hsddyikflrsirpdnmseyskqmqrfnvgedcpvfdglfefcqlstggsvasavklnkq
    qtdiavnwagglhhakkseasgfcyvndivlailellkyhqrvlyididihhgdgveeaf
    yttdrvmtvsfhkygeyfpgtgdlrdigagkgkyyavnyplrdgiddesyeaifkpvmsk
    vmemfqpsavvlqcgsdslsgdrlgcfnltikghakcvefvksfnlpmlmlggggytirn
    varcwtyetavaldteipnelpyndyfeyfgpdfklhispsnmtnqntneylekikqrlf
    enlrmlpha
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5icnC (C:)
    lgkggaxrh
    

    Sequence, based on observed residues (ATOM records):
    >5icnC (C:)
    gaxrh