PDB entry 5ick

View 5ick on RCSB PDB site
Description: A unique binding model of FXR LBD with feroline
Class: transcription
Keywords: Complex, TRANSCRIPTION
Deposited on 2016-02-23, released 2017-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile acid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5icka_
  • Chain 'B':
    Compound: Bile acid receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ickb_
  • Chain 'C':
    Compound: nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Ncoa2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Ncoa2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ickA (A:)
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ickB (B:)
eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.