PDB entry 5icb

View 5icb on RCSB PDB site
Description: bovine calbindin d9k binding mg2+
Class: calcium-binding protein
Keywords: calcium-binding protein, ef-hand, magnesium binding
Deposited on 1997-03-05, released 1997-09-17
The last revision prior to the SCOPe 2.06 freeze date was dated 1997-09-17, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.195
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calbindin d9k
    Species: Bos taurus
    Gene: synthetic gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5icba_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5icbA (A:)
    kspeelkgifekyaakegdpnqlskeelklllqtefpsllkgpstldelfeeldkngdge
    vsfeefqvlvkkisq