PDB entry 5ic2

View 5ic2 on RCSB PDB site
Description: Product-Complex of E.coli 5-Amino Laevulinic Acid Dehydratase
Class: lyase
Keywords: Dehydratase, Lyase, Tetrapyrrole Biosynthesis
Deposited on 2016-02-22, released 2016-03-02
Made obsolete on 2016-12-07

The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: hemB, ncf, b0369, JW0361
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ic2a_
  • Heterogens: PBG, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ic2A (A:)
    mtdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekh
    lareierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtc
    fceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqald
    aagfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqg
    adclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgs
    ikragadlifsyfaldlaekkilr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ic2A (A:)
    tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
    areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
    ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
    agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
    dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
    kragadlifsyfaldlaekkilr