PDB entry 5ic1

View 5ic1 on RCSB PDB site
Description: structural analysis of a talin triple domain module, e1794y, e1797y, q1801y mutant
Deposited on 2016-02-22, released 2016-05-18
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Talin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26039 (3-End)
      • expression tag (2)
      • engineered mutation (440)
      • engineered mutation (443)
      • engineered mutation (447)
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ic1A (A:)
    ghmapgqkecdnalrqletvrellenpvqpindmsyfgcldsvmenskvlgeamtgisqn
    akngnlpefgdaiataskalcgfteaaaqaaylvgvsdpnsqagqqglveptqfaranqa
    iqmacqslgepgctqaqvlsaativakhtsalcnscrlasartanptakrqfvqsakeva
    nstanlvktikaldgdfteenraqcraataplleavdnlsafasnpefssvpaqispegr
    aamepivisaktmlesaggliqtaralavnprdpprwsvlaghsrtvsdsikklitsmrd
    kapgqlecetaiaalnsclrdldqaslaavsqqlapregisqealhtqmltavqeishli
    eplasaaraeasqlghkvsqmaqyfepltlaavgaasktlshpqqmalldqtktlaesal
    qllytakeaggnpkqaahtqyalyeavymmteavedltttlneaasaag
    

    Sequence, based on observed residues (ATOM records):
    >5ic1A (A:)
    mapgqkecdnalrqletvrellenpvqpindmsyfgcldsvmenskvlgeamtgisqnak
    ngnlpefgdaiataskalcgfteaaaqaaylvgvsdpnsqagqqglveptqfaranqaiq
    macqslgepgctqaqvlsaativakhtsalcnscrlasartanptakrqfvqsakevans
    tanlvktikaldgdfteenraqcraataplleavdnlsafasnpefssvpaqispegraa
    mepivisaktmlesaggliqtaralavnprdpprwsvlaghsrtvsdsikklitsmrdka
    pgqlecetaiaalnsclrdldqaslaavsqqlapregisqealhtqmltavqeishliep
    lasaaraeasqlghkvsqmaqyfepltlaavgaasktlshpqqmalldqtktlaesalql
    lytakeaggnpkqaahtqyalyeavymmteavedltttlneaas