PDB entry 5ibz

View 5ibz on RCSB PDB site
Description: crystal structure of a novel cyclase (pfam04199).
Deposited on 2016-02-22, released 2017-08-09
The last revision was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: uncultured organism [TaxId:155900]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: uncultured organism [TaxId:155900]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: uncultured organism [TaxId:155900]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: uncultured organism [TaxId:155900]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: UVW, PGE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ibzA (A:)
    avmahaegpalhpheklnnwgkwgdddqrgaanyitperivaaarliqtgktfslaipid
    sngpvfpprlpphhtmeitgadyvadpgaspfgkspirfaddyiymplqgstqwdalshg
    wygeslyngvpeaairssgaggatklgienvktsflgrgvlvdivrfkggslpegytitr
    adlegalakqkskllpgdilvirtglveswydldpvgrasfflnpmtgigsdtvpwiheq
    rlagvaadnialervpherapelalpvhgnllrdlgvyigeiwwleelakdcaqdgryef
    flaaqplyipgavgsplnpiavk
    

    Sequence, based on observed residues (ATOM records):
    >5ibzA (A:)
    alhpheklnnwgkwgdddqrgaanyitperivaaarliqtgktfslaipidsngpvfppr
    lpphhtmeitgadyvadpgaspspirfaddyiymplqgstqwdalshgwygeslyngvpe
    aairssgaggatklgienvktsflgrgvlvdivrfkggslpegytitradlegalakqks
    kllpgdilvirtglveswydldpvgrasfflnpmtgigsdtvpwiheqrlagvaadnial
    ervphlalpvhgnllrdlgvyigeiwwleelakdcaqdgryefflaaqplyipgavgspl
    npiavk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ibzB (B:)
    avmahaegpalhpheklnnwgkwgdddqrgaanyitperivaaarliqtgktfslaipid
    sngpvfpprlpphhtmeitgadyvadpgaspfgkspirfaddyiymplqgstqwdalshg
    wygeslyngvpeaairssgaggatklgienvktsflgrgvlvdivrfkggslpegytitr
    adlegalakqkskllpgdilvirtglveswydldpvgrasfflnpmtgigsdtvpwiheq
    rlagvaadnialervpherapelalpvhgnllrdlgvyigeiwwleelakdcaqdgryef
    flaaqplyipgavgsplnpiavk
    

    Sequence, based on observed residues (ATOM records):
    >5ibzB (B:)
    alhpheklnnwgkwgdddqrgaanyitperivaaarliqtgktfslaipidsngpvfppr
    lpphhtmeitgadyvadpgaspfgkspirfaddyiymplqgstqwdalshgwygeslyng
    vpeaairssgaggatklgienvktsflgrgvlvdivrfkggslpegytitradlegalak
    qkskllpgdilvirtglveswydldpvgrasfflnpmtgigsdtvpwiheqrlagvaadn
    ialervphalpvhgnllrdlgvyigeiwwleelakdcaqdgryefflaaqplyipgavgs
    plnpiavk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5ibzC (C:)
    avmahaegpalhpheklnnwgkwgdddqrgaanyitperivaaarliqtgktfslaipid
    sngpvfpprlpphhtmeitgadyvadpgaspfgkspirfaddyiymplqgstqwdalshg
    wygeslyngvpeaairssgaggatklgienvktsflgrgvlvdivrfkggslpegytitr
    adlegalakqkskllpgdilvirtglveswydldpvgrasfflnpmtgigsdtvpwiheq
    rlagvaadnialervpherapelalpvhgnllrdlgvyigeiwwleelakdcaqdgryef
    flaaqplyipgavgsplnpiavk
    

    Sequence, based on observed residues (ATOM records):
    >5ibzC (C:)
    klnnwgkwgdddqrgaanyitperivaaarliqtgktfslaipidsngpvfpprlpphht
    meitgadyvadpgaspfgkspirfaddyiymplqgstqwdalshgwygeslyngvpeaai
    rssgaggatklgienvktsflgrgvlvdivrfkggslpegytitradlegalakqkskll
    pgdilvirtglveswydldpvgrasfflnpmtgigsdtvpwiheqrlagvaadnialerv
    phlpvhgnllrdlgvyigeiwwleelakdcaqdgryefflaaqplyipgavgsplnpiav
    k
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5ibzD (D:)
    avmahaegpalhpheklnnwgkwgdddqrgaanyitperivaaarliqtgktfslaipid
    sngpvfpprlpphhtmeitgadyvadpgaspfgkspirfaddyiymplqgstqwdalshg
    wygeslyngvpeaairssgaggatklgienvktsflgrgvlvdivrfkggslpegytitr
    adlegalakqkskllpgdilvirtglveswydldpvgrasfflnpmtgigsdtvpwiheq
    rlagvaadnialervpherapelalpvhgnllrdlgvyigeiwwleelakdcaqdgryef
    flaaqplyipgavgsplnpiavk
    

    Sequence, based on observed residues (ATOM records):
    >5ibzD (D:)
    klnnwgkwgdddqrgaanyitperivaaarliqtgktfslaipidsngpvfpprlpphht
    meitgadyvadpgaspfspirfaddyiymplqgstqwdalshgwygeslyngvpeaairs
    sgaggatklgienvktsflgrgvlvdivrfkggslpegytitradlegalakqkskllpg
    dilvirtglveswydldpvgrasfflnpmtgigsdtvpwiheqrlagvaadnialervph
    alpvhgnllrdlgvyigeiwwleelakdcaqdgryefflaaqplyipgavgsplnpiavk