PDB entry 5ibw

View 5ibw on RCSB PDB site
Description: complex of mlcc bound to the tandem iq motif of myoc
Deposited on 2016-02-22, released 2016-08-03
The last revision was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-binding EF-hand domain-containing protein
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: DDB_G0289563
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54HC2 (3-76)
      • expression tag (1-2)
  • Chain 'B':
    Compound: Calcium-binding EF-hand domain-containing protein
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: DDB_G0289563
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Myosin IC heavy chain
    Species: DICTYOSTELIUM DISCOIDEUM [TaxId:44689]
    Gene: myoC, dmiC, DDB_G0276617
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42522 (2-42)
      • expression tag (0-1)
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ibwA (A:)
    gshmnhintkaqvieafkvfdrdgngyvtvdylrkvlnelgdmmpadeieemiyeadpqn
    sgyvqyetfvgmlflwd
    

    Sequence, based on observed residues (ATOM records):
    >5ibwA (A:)
    shmnhintkaqvieafkvfdrdgngyvtvdylrkvlnelgdmmpadeieemiyeadpqns
    gyvqyetfvgmlflwd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ibwB (B:)
    gshmnhintkaqvieafkvfdrdgngyvtvdylrkvlnelgdmmpadeieemiyeadpqn
    sgyvqyetfvgmlflwd
    

    Sequence, based on observed residues (ATOM records):
    >5ibwB (B:)
    nhintkaqvieafkvfdrdgngyvtvdylrkvlnelgdmmpadeieemiyeadpqnsgyv
    qyetfvgmlflwd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5ibwC (C:)
    gsrywhdmasriknayrnykafqfecsnriknafrnyklyrqr