PDB entry 5i9x

View 5i9x on RCSB PDB site
Description: Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with bosutinib (SKI-606)
Class: transferase
Keywords: transferase, tyrosine-protein kinase, receptor, ATP-binding
Deposited on 2016-02-21, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHA2, ECK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i9xa_
  • Heterogens: DB8, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i9xA (A:)
    gdpnqavlkftteihpscvtrqkvigagefgevykgmlktssgkkevpvaiktlkagyte
    kqrvdflgeagimgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvl
    qlvgmlrgiaagmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvleddpeatytt
    sggkipirwtapeaisyrkftsasdvwsfgivmwevmtygerpywelsnhevmkaindgf
    rlptpmdcpsaiyqlmmqcwqqerarrpkfadivsildklirapdslktladfdprvsir
    lpstsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i9xA (A:)
    ftteihpscvtrqkvigagefgevykgmlktevpvaiktlkagytekqrvdflgeagimg
    qfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgiaagmk
    ylanmnyvhrdlaarnilvnsnlvckvsdfglsrvleddpeatygkipirwtapeaisyr
    kftsasdvwsfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmq
    cwqqerarrpkfadivsildklirapdslktladfdprvsirlp