PDB entry 5i9o

View 5i9o on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS L36K L103K at cryogenic temperature
Class: hydrolase
Keywords: nuclease, hyperstable, pdTp, hydrolase, ionizable group, pH switch
Deposited on 2016-02-20, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (35)
      • engineered mutation (43-44)
      • engineered mutation (96)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d5i9oa_
  • Chain 'B':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (35)
      • engineered mutation (43-44)
      • engineered mutation (96)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.07: d5i9ob_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i9oA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrkllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvneakvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i9oA (A:)
    lhkepatlikaidgdtvklmykgqpmtfrkllvdtpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglayiyadgkmvneakvrqglakvayvykgnntheqllrkaeaqa
    kkeklniws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i9oB (B:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrkllvdtpefnekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvneakvrqglakvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i9oB (B:)
    lhkepatlikaidgdtvklmykgqpmtfrkllvdtpefnekygpeasaftkkmvenakki
    evefdkgqrtdkygrglayiyadgkmvneakvrqglakvayvykgnntheqllrkaeaqa
    kkeklniws