PDB entry 5i9k

View 5i9k on RCSB PDB site
Description: the structure of microsomal glutathione transferase 1
Deposited on 2016-02-20, released 2017-07-12
The last revision was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: ELECTRONCRYSTALLOGRAPHY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microsomal glutathione S-transferase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Mgst1, Gst12
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GSH, PC1, PLM

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i9kA (A:)
    madlkqlmdnevlmaftsyatiilakmmflssatafqrltnkvfanpedcagfgkgenak
    kflrtdekvervrrahlndlenivpflgigllyslsgpdlstalihfrifvgariyhtia
    yltplpqpnrglaffvgygvtlsmayrllrsrlyl
    

    Sequence, based on observed residues (ATOM records):
    >5i9kA (A:)
    nevlmaftsyatiilakmmflssatafqrltnkdekvervrrahlndlenivpflgigll
    yslsgpdlstalihfrifvgariyhtiayltplpqpnrglaffvgygvtlsmayrllrsr
    lyl