PDB entry 5i9e

View 5i9e on RCSB PDB site
Description: Crystal structure of a nuclear actin ternary complex
Class: hydrolase
Keywords: nuclear actin, Arp4, chromatin remodeling, HYDROLASE
Deposited on 2016-02-20, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-related protein 4
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ARP4, ACT3, YJL081C, J1012
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80428 (1-489)
      • expression tag (0)
  • Chain 'B':
    Compound: actin
    Species: Saccharomyces bayanus [TaxId:4931]
    Gene: ACT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i9eb1, d5i9eb2
  • Chain 'C':
    Compound: Actin-related protein 4
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ARP4, ACT3, YJL081C, J1012
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: actin
    Species: Saccharomyces bayanus [TaxId:4931]
    Gene: ACT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i9ed1, d5i9ed2
  • Chain 'E':
    Compound: Helicase SWR1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SWR1, YDR334W, D9651.6
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Helicase SWR1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SWR1, YDR334W, D9651.6
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, ATP

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i9eB (B:)
    mdsevaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqs
    krgiltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmt
    qimfetfnvpafyvsiqavlslyssgrttgivldsgdgvthvvpiyagfslphailridl
    agrdltdylmkilsergysfsttaereivrdikeklcyvaldfeqemqtaaqsssieksy
    elpdgqvitignerfrapealfhpsvlglesagidqttynsimkcdvdvrkelygnivms
    ggttmfpgiaermqkeitalapssmkvkiiapperkysvwiggsilaslttfqqmwiskq
    eydesgpsivhhkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i9eB (B:)
    vaalvidngsgmckagfagddapravfpsivgrsyvgdeaqskrgiltlrypiehgivtn
    wddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqimfetfnvpafyvsiqa
    vlslyssgrttgivldsgdgvthvvpiyagfslphailridlagrdltdylmkilserta
    ereivrdikeklcyvaldfeqemqtaaqsssieksyelpdgqvitignerfrapealfhp
    svlglesagidqttynsimkcdvdvrkelygnivmsggttmfpgiaermqkeitalapss
    mkvkiiapperkysvwiggsilaslttfqqmwiskqeydesgpsivhhkcf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5i9eD (D:)
    mdsevaalvidngsgmckagfagddapravfpsivgrprhqgimvgmgqkdsyvgdeaqs
    krgiltlrypiehgivtnwddmekiwhhtfynelrvapeehpvllteapmnpksnrekmt
    qimfetfnvpafyvsiqavlslyssgrttgivldsgdgvthvvpiyagfslphailridl
    agrdltdylmkilsergysfsttaereivrdikeklcyvaldfeqemqtaaqsssieksy
    elpdgqvitignerfrapealfhpsvlglesagidqttynsimkcdvdvrkelygnivms
    ggttmfpgiaermqkeitalapssmkvkiiapperkysvwiggsilaslttfqqmwiskq
    eydesgpsivhhkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i9eD (D:)
    vaalvidngsgmckagfagddapravfpsivgrsyvgdeaqskrgiltlrypiehgivtn
    wddmekiwhhtfynelrvapeehpvllteapmnpksnrekmtqimfetfnvpafyvsiqa
    vlslyssgrttgivldsgdgvthvvpiyagfslphailridlagrdltdylmkilserae
    reivrdikeklcyvaldfeqemqtaaqsssiekgnerfrapealfhpsvlglesagidqt
    tynsimkcdvdvrkelygnivmsggttmfpgiaermqkeitalapssmkvkiiapperky
    svwiggsilaslttfqqmwiskqeydesgpsivhhkcf
    

  • Chain 'E':
    No sequence available.

  • Chain 'H':
    No sequence available.