PDB entry 5i9b

View 5i9b on RCSB PDB site
Description: caspase 3 v266a
Deposited on 2016-02-19, released 2016-10-26
The last revision was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caspase-3
    Species: Homo sapiens [TaxId:9606]
    Gene: CASP3, CPP32
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42574 (Start-276)
      • engineered mutation (265)
      • expression tag (277)
  • Chain 'B':
    Compound: ace-asp-glu-val-ask
    Species: UNIDENTIFIED, synthetic [TaxId:32644]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I9B (Start-4)
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i9bA (A:)
    mentensvdsksiknlepkiihgsesmdsgisldnsykmdypemglciiinnknfhkstg
    mtsrsgtdvdaanlretfrnlkyevrnkndltreeivelmrdvskedhskrssfvcvlls
    hgeegiifgtngpvdlkkitnffrgdrcrsltgkpklfiiqacrgteldcgietdsgvdd
    dmachkipveadflyaystapgyyswrnskdgswfiqslcamlkqyadklefmhiltrvn
    rkvatefesfsfdatfhakkqipciasmltkelyfyhl
    

    Sequence, based on observed residues (ATOM records):
    >5i9bA (A:)
    sgisldnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnk
    ndltreeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrc
    rsltgkpklfiiqacrgteldcgiethkipveadflyaystapgyyswrnskdgswfiqs
    lcamlkqyadklefmhiltrvnrkvatefesfsfdatfhakkqipciasmltkelyfyhl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5i9bB (B:)
    devdx