PDB entry 5i98

View 5i98 on RCSB PDB site
Description: Structure of apo FKBP12(P104G) from C. albicans
Class: isomerase
Keywords: FKBP12, Self-catalysis, ISOMERASE
Deposited on 2016-02-19, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FK506-binding protein 1
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: RBP1, RBP11, CaO19.11186, CaO19.3702, RBP2, RBP12, CaJ7.0299, CaO19.13810, CaO19.6452
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28870 (0-119)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d5i98a_
  • Chain 'B':
    Compound: FK506-binding protein 1
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: RBP1, RBP11, CaO19.11186, CaO19.3702, RBP2, RBP12, CaJ7.0299, CaO19.13810, CaO19.6452
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28870 (Start-119)
      • engineered mutation (101)
    Domains in SCOPe 2.07: d5i98b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i98A (A:)
    eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
    wdisltnnygkgganlpkiskgtkailtippnlaygprgipgiigpnetlvfevellgvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i98B (B:)
    eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
    wdisltnnygkgganlpkiskgtkailtippnlaygprgipgiigpnetlvfevellgvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i98B (B:)
    elpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikgw
    disltnnygkgganlpkiskgtkailtippnlaygprgipgiigpnetlvfevellgvn