PDB entry 5i92

View 5i92 on RCSB PDB site
Description: Crystal structure of Glutamate-1-semialdehyde 2,1- aminomutase (GSA) from Pseudomonas aeruginosa
Class: isomerase
Keywords: SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, ISOMERASE
Deposited on 2016-02-19, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate-1-semialdehyde 2,1-aminomutase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: hemL, PA3977
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i92a_
  • Chain 'B':
    Compound: Glutamate-1-semialdehyde 2,1-aminomutase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: hemL, PA3977
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i92b_
  • Chain 'C':
    Compound: Glutamate-1-semialdehyde 2,1-aminomutase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: hemL, PA3977
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i92c_
  • Chain 'D':
    Compound: Glutamate-1-semialdehyde 2,1-aminomutase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: hemL, PA3977
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i92d_
  • Chain 'E':
    Compound: Glutamate-1-semialdehyde 2,1-aminomutase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: hemL, PA3977
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i92e_
  • Chain 'F':
    Compound: Glutamate-1-semialdehyde 2,1-aminomutase
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: hemL, PA3977
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i92f_
  • Heterogens: GOL, EDO, LEU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i92A (A:)
    mahhhhhhmsrsetlfnnaqkhipggvnspvrafksvggtplffkhaegayvldeddkry
    vdyvgswgpmilghshpdvldavrrqldhglsygaptalevemadlvcsmvpsmemvrmv
    ssgteatmsairlargytgrdsiikfegcyhghsdsllvkagsgaltfgvpnspgvpaaf
    akhtltlpfndieavrktlgevgkevaciivepvagnmncvppapgfleglreacdehgv
    vlifdevmtgfrvalggaqayygvtpdlstfgkiigggmpvgafggkreimqqisplgpv
    yqagtlsgnplamaaglttlrlisrpgfhdeltayttrmldglqqradaagipfvttqag
    gmfglyfsgadaivtfedvmasdverfkrffhlmldggvylapsafeagftsiahgdkel
    eitlnaaekafaalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i92A (A:)
    msrsetlfnnaqkhipggvnspvrafksvggtplffkhaegayvldeddkryvdyvgswg
    pmilghshpdvldavrrqldhglsygaptalevemadlvcsmvpsmemvrmvssgteatm
    sairlargytgrdsiikfegcyhghsdsllvkagstfgvpnspgvpaafakhtltlpfnd
    ieavrktlgevgkevaciivepvagnmncvppapgfleglreacdehgvvlifdevmtgf
    rvalggaqayygvtpdlstfgkiigggmpvgafggkreimqqisplgpvyqagtlsgnpl
    amaaglttlrlisrpgfhdeltayttrmldglqqradaagipfvttqaggmfglyfsgad
    aivtfedvmasdverfkrffhlmldggvylapsafeagftsiahgdkeleitlnaaekaf
    aalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i92B (B:)
    mahhhhhhmsrsetlfnnaqkhipggvnspvrafksvggtplffkhaegayvldeddkry
    vdyvgswgpmilghshpdvldavrrqldhglsygaptalevemadlvcsmvpsmemvrmv
    ssgteatmsairlargytgrdsiikfegcyhghsdsllvkagsgaltfgvpnspgvpaaf
    akhtltlpfndieavrktlgevgkevaciivepvagnmncvppapgfleglreacdehgv
    vlifdevmtgfrvalggaqayygvtpdlstfgkiigggmpvgafggkreimqqisplgpv
    yqagtlsgnplamaaglttlrlisrpgfhdeltayttrmldglqqradaagipfvttqag
    gmfglyfsgadaivtfedvmasdverfkrffhlmldggvylapsafeagftsiahgdkel
    eitlnaaekafaalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i92B (B:)
    msrsetlfnnaqkhipggvnspvrafksvggtplffkhaegayvldeddkryvdyvgswg
    pmilghshpdvldavrrqldhglsygaptalevemadlvcsmvpsmemvrmvssgteatm
    sairlargytgrdsiikfegcyhghsdsllvkagstfgvpnspgvpaafakhtltlpfnd
    ieavrktlgevgkevaciivepvagnmncvppapgfleglreacdehgvvlifdevmtgf
    rvalggaqayygvtpdlstfgkiigggmpvgafggkreimqqisplgpvyqagtgnplam
    aaglttlrlisrpgfhdeltayttrmldglqqradaagipfvttqaggmfglyfsgadai
    vtfedvmasdverfkrffhlmldggvylapsafeagftsiahgdkeleitlnaaekafaa
    l
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5i92C (C:)
    mahhhhhhmsrsetlfnnaqkhipggvnspvrafksvggtplffkhaegayvldeddkry
    vdyvgswgpmilghshpdvldavrrqldhglsygaptalevemadlvcsmvpsmemvrmv
    ssgteatmsairlargytgrdsiikfegcyhghsdsllvkagsgaltfgvpnspgvpaaf
    akhtltlpfndieavrktlgevgkevaciivepvagnmncvppapgfleglreacdehgv
    vlifdevmtgfrvalggaqayygvtpdlstfgkiigggmpvgafggkreimqqisplgpv
    yqagtlsgnplamaaglttlrlisrpgfhdeltayttrmldglqqradaagipfvttqag
    gmfglyfsgadaivtfedvmasdverfkrffhlmldggvylapsafeagftsiahgdkel
    eitlnaaekafaalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i92C (C:)
    msrsetlfnnaqkhipggvnspvrafksvggtplffkhaegayvldeddkryvdyvgswg
    pmilghshpdvldavrrqldhglsygaptalevemadlvcsmvpsmemvrmvssgteatm
    sairlargytgrdsiikfegcyhghsdsllvkagstfgvpnspgvpaafakhtltlpfnd
    ieavrktlgevgkevaciivepvagnmncvppapgfleglreacdehgvvlifdevmtgf
    rvalggaqayygvtpdlstfgkiigggmpvgafggkreimqqisplgpvyqagtlnplam
    aaglttlrlisrpgfhdeltayttrmldglqqradaagipfvttqaggmfglyfsgadai
    vtfedvmasdverfkrffhlmldggvylapsafeagftsiahgdkeleitlnaaekafaa
    l
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5i92D (D:)
    mahhhhhhmsrsetlfnnaqkhipggvnspvrafksvggtplffkhaegayvldeddkry
    vdyvgswgpmilghshpdvldavrrqldhglsygaptalevemadlvcsmvpsmemvrmv
    ssgteatmsairlargytgrdsiikfegcyhghsdsllvkagsgaltfgvpnspgvpaaf
    akhtltlpfndieavrktlgevgkevaciivepvagnmncvppapgfleglreacdehgv
    vlifdevmtgfrvalggaqayygvtpdlstfgkiigggmpvgafggkreimqqisplgpv
    yqagtlsgnplamaaglttlrlisrpgfhdeltayttrmldglqqradaagipfvttqag
    gmfglyfsgadaivtfedvmasdverfkrffhlmldggvylapsafeagftsiahgdkel
    eitlnaaekafaalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i92D (D:)
    msrsetlfnnaqkhipggvnspvrafksvggtplffkhaegayvldeddkryvdyvgswg
    pmilghshpdvldavrrqldhglsygaptalevemadlvcsmvpsmemvrmvssgteatm
    sairlargytgrdsiikfegcyhghsdsllvkagstfgvpnspgvpaafakhtltlpfnd
    ieavrktlgevgkevaciivepvagnmncvppapgfleglreacdehgvvlifdevmtgf
    rvalggaqayygvtpdlstfgkiigggmpvgafggkreimqqisplgpvyqagtlsgnpl
    amaaglttlrlisrpgfhdeltayttrmldglqqradaagipfvttqaggmfglyfsgad
    aivtfedvmasdverfkrffhlmldggvylapsafeagftsiahgdkeleitlnaaekaf
    aal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5i92E (E:)
    mahhhhhhmsrsetlfnnaqkhipggvnspvrafksvggtplffkhaegayvldeddkry
    vdyvgswgpmilghshpdvldavrrqldhglsygaptalevemadlvcsmvpsmemvrmv
    ssgteatmsairlargytgrdsiikfegcyhghsdsllvkagsgaltfgvpnspgvpaaf
    akhtltlpfndieavrktlgevgkevaciivepvagnmncvppapgfleglreacdehgv
    vlifdevmtgfrvalggaqayygvtpdlstfgkiigggmpvgafggkreimqqisplgpv
    yqagtlsgnplamaaglttlrlisrpgfhdeltayttrmldglqqradaagipfvttqag
    gmfglyfsgadaivtfedvmasdverfkrffhlmldggvylapsafeagftsiahgdkel
    eitlnaaekafaalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i92E (E:)
    msrsetlfnnaqkhipggvnspvrafksvggtplffkhaegayvldeddkryvdyvgswg
    pmilghshpdvldavrrqldhglsygaptalevemadlvcsmvpsmemvrmvssgteatm
    sairlargytgrdsiikfegcyhghsdsllvkagstfgvpnspgvpaafakhtltlpfnd
    ieavrktlgevgkevaciivepvagnmncvppapgfleglreacdehgvvlifdevmtgf
    rvalggaqayygvtpdlstfgkiigggmpvgafggkreimqqisplgpvyqagtlnplam
    aaglttlrlisrpgfhdeltayttrmldglqqradaagipfvttqaggmfglyfsgadai
    vtfedvmasdverfkrffhlmldggvylapsafeagftsiahgdkeleitlnaaekafaa
    l
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5i92F (F:)
    mahhhhhhmsrsetlfnnaqkhipggvnspvrafksvggtplffkhaegayvldeddkry
    vdyvgswgpmilghshpdvldavrrqldhglsygaptalevemadlvcsmvpsmemvrmv
    ssgteatmsairlargytgrdsiikfegcyhghsdsllvkagsgaltfgvpnspgvpaaf
    akhtltlpfndieavrktlgevgkevaciivepvagnmncvppapgfleglreacdehgv
    vlifdevmtgfrvalggaqayygvtpdlstfgkiigggmpvgafggkreimqqisplgpv
    yqagtlsgnplamaaglttlrlisrpgfhdeltayttrmldglqqradaagipfvttqag
    gmfglyfsgadaivtfedvmasdverfkrffhlmldggvylapsafeagftsiahgdkel
    eitlnaaekafaalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i92F (F:)
    msrsetlfnnaqkhipggvnspvrafksvggtplffkhaegayvldeddkryvdyvgswg
    pmilghshpdvldavrrqldhglsygaptalevemadlvcsmvpsmemvrmvssgteatm
    sairlargytgrdsiikfegcyhghsdsllvkagstfgvpnspgvpaafakhtltlpfnd
    ieavrktlgevgkevaciivepvagnmncvppapgfleglreacdehgvvlifdevmtgf
    rvalggaqayygvtpdlstfgkiigggmpvgafggkreimqqisplgpvyqagtgnplam
    aaglttlrlisrpgfhdeltayttrmldglqqradaagipfvttqaggmfglyfsgadai
    vtfedvmasdverfkrffhlmldggvylapsafeagftsiahgdkeleitlnaaekafaa