PDB entry 5i8x

View 5i8x on RCSB PDB site
Description: bicyclic antimibrocial peptides
Deposited on 2016-02-19, released 2017-08-23
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fucose-binding lectin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lecB, AN280_27645, AN399_05715, AN400_17270, AN446_25935, AN447_15925, AN451_21855, AN453_22575, AN455_18155, AN456_19070, AN457_11175, AN458_15745, AN460_27980, AN462_17515, AOD73_08535, AOX61_23230, AOX62_26425, APG03_22020, APG04_23970, APG05_03535, APG06_28020, APG07_27985, ATC05_02360, ERS445055_01627, PA8380_17510, PAERUG_E15_London_28_01_14_00983, PAERUG_P32_London_17_VIM_2_10_11_00423, PAMH19_1713, PAO1OR1608
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Fucose-binding lectin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lecB, AN280_27645, AN399_05715, AN400_17270, AN446_25935, AN447_15925, AN451_21855, AN453_22575, AN455_18155, AN456_19070, AN457_11175, AN458_15745, AN460_27980, AN462_17515, AOD73_08535, AOX61_23230, AOX62_26425, APG03_22020, APG04_23970, APG05_03535, APG06_28020, APG07_27985, ATC05_02360, ERS445055_01627, PA8380_17510, PAERUG_E15_London_28_01_14_00983, PAERUG_P32_London_17_VIM_2_10_11_00423, PAMH19_1713, PAO1OR1608
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Fucose-binding lectin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lecB, AN280_27645, AN399_05715, AN400_17270, AN446_25935, AN447_15925, AN451_21855, AN453_22575, AN455_18155, AN456_19070, AN457_11175, AN458_15745, AN460_27980, AN462_17515, AOD73_08535, AOX61_23230, AOX62_26425, APG03_22020, APG04_23970, APG05_03535, APG06_28020, APG07_27985, ATC05_02360, ERS445055_01627, PA8380_17510, PAERUG_E15_London_28_01_14_00983, PAERUG_P32_London_17_VIM_2_10_11_00423, PAMH19_1713, PAO1OR1608
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Fucose-binding lectin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: lecB, AN280_27645, AN399_05715, AN400_17270, AN446_25935, AN447_15925, AN451_21855, AN453_22575, AN455_18155, AN456_19070, AN457_11175, AN458_15745, AN460_27980, AN462_17515, AOD73_08535, AOX61_23230, AOX62_26425, APG03_22020, APG04_23970, APG05_03535, APG06_28020, APG07_27985, ATC05_02360, ERS445055_01627, PA8380_17510, PAERUG_E15_London_28_01_14_00983, PAERUG_P32_London_17_VIM_2_10_11_00423, PAMH19_1713, PAO1OR1608
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: dls-lys-cys-lys-leu-cys-lys-lys-nh2
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I8X (0-End)
  • Heterogens: ZDC, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5i8xA (A:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5i8xB (B:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >5i8xC (C:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5i8xD (D:)
    atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
    gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >5i8xE (E:)
    kkcklclk