PDB entry 5i8t

View 5i8t on RCSB PDB site
Description: Structure of Mouse Acireductone dioxygenase with Ni2+ ion and D-lactic acid in the active site
Class: oxidoreductase
Keywords: Substrate analog, D-lactic acid, OXIDOREDUCTASE
Deposited on 2016-02-19, released 2016-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
    Species: Mus musculus [TaxId:10090]
    Gene: Adi1, Mtcbp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5i8ta_
  • Heterogens: NI, LAC, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5i8tA (A:)
mvqawymdestadprkphraqpdrpvsleqlrtlgvlywkldadkyendpelekirkmrn
yswmdiitickdtlpnyeekikmffeehlhldeeiryilegsgyfdvrdkedkwirisme
kgdmitlpagiyhrftldeknyvkamrlfvgepvwtpynrpadhfdarvqymsflegta