PDB entry 5i8s

View 5i8s on RCSB PDB site
Description: Structure of Mouse Acireductone dioxygenase with Ni2+ ion and pentanoic acid in the active site
Class: oxidoreductase
Keywords: Product analog, off-pathway chemistry, OXIDOREDUCTASE
Deposited on 2016-02-19, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
    Species: Mus musculus [TaxId:10090]
    Gene: Adi1, Mtcbp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i8sa_
  • Heterogens: NI, LEA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5i8sA (A:)
mvqawymdestadprkphraqpdrpvsleqlrtlgvlywkldadkyendpelekirkmrn
yswmdiitickdtlpnyeekikmffeehlhldeeiryilegsgyfdvrdkedkwirisme
kgdmitlpagiyhrftldeknyvkamrlfvgepvwtpynrpadhfdarvqymsflegta