PDB entry 5i8p

View 5i8p on RCSB PDB site
Description: crystal structure of lp_pla2 in complex with novel inhibitor
Deposited on 2016-02-19, released 2016-06-15
The last revision was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: platelet-activating factor acetylhydrolase
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G7, PAFAH
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: platelet-activating factor acetylhydrolase
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G7, PAFAH
    Database cross-references and differences (RAF-indexed):
  • Heterogens: VQ7, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5i8pA (A:)
    gplgsaaasfgqtkiprgngpysvgctdlmfdhtnkgtflrlyypsqdndrldtlwipnk
    eyfwglskflgthwlmgnilrllfgsmttpanwnsplrpgekyplvvfshglgafrtlys
    aigidlashgfivaavehrdrsasatyyfkdqsaaeigdkswlylrtlkqeeethirneq
    vrqrakecsqalslildidhgkpvknaldlkfdmeqlkdsidrekiavighsfggatviq
    tlsedqrfrcgialdawmfplgdevysripqplffinseyfqypaniikmkkcyspdker
    kmitirgsvhqnfadftfatgkiighmlklkgdidsnvaidlsnkaslaflqkhlglhkd
    fdqwdcliegddenlipgtninttnqhi
    

    Sequence, based on observed residues (ATOM records):
    >5i8pA (A:)
    tkiprgngpysvgctdlmfdhtnkgtflrlyypsqdndrldtlwipnkeyfwglskflgt
    hwlmgnilrllfgsmttpanwnsplrpgekyplvvfshglgafrtlysaigidlashgfi
    vaavehrdrsasatyyfkdqsaaeigdkswlylrtlkqeeethirneqvrqrakecsqal
    slildidhgkpvknaldlkfdmeqlkdsidrekiavighsfggatviqtlsedqrfrcgi
    aldawmfplgdevysripqplffinseyfqypaniikmkkcyspdkerkmitirgsvhqn
    fadftfatgkiighmlklkgdidsnvaidlsnkaslaflqkhlglhkdfdqwdcliegdd
    enlipgtni
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5i8pB (B:)
    gplgsaaasfgqtkiprgngpysvgctdlmfdhtnkgtflrlyypsqdndrldtlwipnk
    eyfwglskflgthwlmgnilrllfgsmttpanwnsplrpgekyplvvfshglgafrtlys
    aigidlashgfivaavehrdrsasatyyfkdqsaaeigdkswlylrtlkqeeethirneq
    vrqrakecsqalslildidhgkpvknaldlkfdmeqlkdsidrekiavighsfggatviq
    tlsedqrfrcgialdawmfplgdevysripqplffinseyfqypaniikmkkcyspdker
    kmitirgsvhqnfadftfatgkiighmlklkgdidsnvaidlsnkaslaflqkhlglhkd
    fdqwdcliegddenlipgtninttnqhi
    

    Sequence, based on observed residues (ATOM records):
    >5i8pB (B:)
    kiprgngpysvgctdlmfdhtnkgtflrlyypsqldtlwipnkeyfwglskflgtwlmgn
    ilrllfgsmttpanwnsplrpgekyplvvfshglgafrtlysaigidlashgfivaaveh
    rdrsasatyyfkdqsaaeigdkswlylrtlkqeeethirneqvrqrakecsqalslildi
    dhgkpvknaldlkfdmeqlkdsidrekiavighsfggatviqtlsedqrfrcgialdawm
    fplgdevysripqplffinseyfqypaniikmkkcyspdkerkmitirgsvhqnfadftf
    atgkiighmlklkgdidsnvaidlsnkaslaflqkhlglhkdfdqwdcliegddenlipg
    tnintt